Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
+ 31 27-256 230 1-26, 257-266 26 10 knot
Fingerprint Knot forming loop Loop type
K +31 Ala1 ... His93 <->
Bridging ionZn301
<-> His95 ...
Chain closureHis266 <-> Ala1
probabilistic
K +31
Chain closureAla1 <-> His266
... His118 <->
Bridging ionZn301
<-> His95 ... Ala1
probabilistic
K +31 Ala1 ... His93 <->
Bridging ionZn301
<-> His118 ...
Chain closureHis266 <-> Ala1
probabilistic
Chain Sequence
AHHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHTFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSHDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSANPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVSKFRKLNFNG-GEPEEPMVDNWRPTQPLKNRQIKASFKHHHHHH

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling