Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K

  Help Knotting data interpretation
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
+ 31 22-248 227 1-21, 249-256 21 8 knot
Fingerprint Knot forming loop Loop type
K +31
Chain closureHis140 <-> Asp395
... His228 <->
Bridging ionZn401
<-> His226 ... His140		 probabilistic
K +31
Chain closureHis140 <-> Asp395
... His251 <->
Bridging ionZn401
<-> His228 ... His140		 probabilistic
K +31
Chain closureHis140 <-> Asp395
... His251 <->
Bridging ionZn401
<-> His226 ... His140		 probabilistic
Chain Sequence
HWRYGGDPPWPRVSPACAGRFQSPVDIRPQLAAFSPALRPLELSGFQLPPLPELRLRNNGHSVQLTLPPGLEMKLGPGREYRALQLHLHWGAAGRPGSEHTVEGHRFPAEIHVVHLSTKYARVDEALGRPGGLAVLAAFLEEGPEENSAYEQLLSRLEEIAEEGSETQVPGLDISALLPSDFSRYFQYEGSLTTPPCAQGVIWTVFNQTVSLSAKQLHTLSDTLWGPGDSRLQLNFRATQPLNGRVIEASFPAGVD
How to cite
KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling