Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
+ 31 23-232 210 1-22, 233-236 22 4 knot
Fingerprint Knot forming loop Loop type
K +31 Trp5 ... His96 <-> His119 ...
Chain closureAla262 <-> Trp5
probabilistic
K +31
Chain closureTrp5 <-> Ala262
... Cys178 <-> Cys54 ... Trp5
probabilistic
K +31 Trp5 ... His94 <-> His119 ...
Chain closureAla262 <-> Trp5
probabilistic
K +31 Trp5 ... His94 <-> His96 ...
Chain closureAla262 <-> Trp5
probabilistic
Chain Sequence
WGYGQDDGPSHWHKLYPIAQGDRQSPINIISSQAVYSPSLQPLELSYEACMSLSITNNGHSVQVDFNDSDDRTVVTGGPLEGPYRLKQFHFHWGKKHDVGSEHTVDGKSFPSELHLVHWNAKKYSTFGEAASAPDGLAVVGVFLETGDEHPSMNRLTDALYMVRFKGTKAQFSCFNPKSLLPASRHYWTYPGSLTTPPLSESVTWIVLREPISISERQMGKFRSLLFTSEDDERIHMVNNFRPPQPLKGRVVKASFRA

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling