Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
+ 31 26-234 209 1-25, 235-238 25 4 knot
Fingerprint Knot forming loop Loop type
K +31 Ser2 ... His96 <-> His119 ...
Chain closureLys261 <-> Ser2
probabilistic
K +31 Ser2 ... His94 <-> His96 ...
Chain closureLys261 <-> Ser2
probabilistic
K +31 Ser2 ... His94 <-> His119 ...
Chain closureLys261 <-> Ser2
probabilistic
Chain Sequence
SHHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHSFQVTFDDSQDKAVLKGGPLDGTYRLLQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDVDKALQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTEGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLAEGVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling