8CA2 | KnotProt

Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!

Knot K

Help Knotting data interpretation

		Knot core range	Knot core length	Knot tails range	Slipknot tails range	Slipknot loops range	N-end length	C-end length	Type
view details	+ 3₁	25-186	162	1-24, 187-189			24	3	knot
view details	+ 3₁	21-253	233	254-256	1-1	2-20	1	2	slipknot
view details	+ 3₁	23-232	210	1-22, 233-235			22	3	knot
view details	+ 3₁	15-230	216	1-14, 231-233			14	3	knot
view details	+ 3₁	25-188	164	189-190	1-1	2-24	1	1	slipknot
view details	+ 3₁	21-186	166	1-20, 187-189			20	3	knot
view details	+ 3₁	26-165	140	1-25, 166-168			25	3	knot
view details	+ 3₁	23-163	141	1-22, 164-166			22	3	knot
view details	+ 3₁	22-187	166	1-21, 188-190			21	2	slipknot
view details	+ 3₁	25-166	142	1-24, 167-169			24	3	knot
view details	+ 3₁	22-163	142	1-21, 164-167			21	4	knot

	Fingerprint	Knot forming loop	Loop type
knots details	K +3₁	Trp5 ... Gln137 <-> Bridging ionHg263 <-> Cys206 ... Chain closurePhe260 <-> Trp5	probabilistic	color sequence
knots details	K +3₁	Trp5 ... His94 <-> Bridging ionZn262 <-> His96 ... Chain closurePhe260 <-> Trp5	probabilistic	color sequence
knots details	K +3₁	Trp5 ... His96 <-> Bridging ionZn262 <-> His119 ... Chain closurePhe260 <-> Trp5	probabilistic	color sequence
knots details	K +3₁	Trp5 ... His94 <-> Bridging ionZn262 <-> His119 ... Chain closurePhe260 <-> Trp5	probabilistic	color sequence
knots details	K +3₁	Trp5 ... Gln137 <-> Bridging ionHg263 <-> Glu205 ... Chain closurePhe260 <-> Trp5	probabilistic	color sequence
knots details	K +3₁	Trp5 ... His94 <-> Bridging ionZn262 <-> His96 ... Gln137 <-> Bridging ionHg263 <-> Cys206 ... Chain closurePhe260 <-> Trp5	probabilistic	color sequence
knots details	K +3₁	Trp5 ... His96 <-> Bridging ionZn262 <-> His119 ... Gln137 <-> Bridging ionHg263 <-> Cys206 ... Chain closurePhe260 <-> Trp5	probabilistic	color sequence
knots details	K +3₁	Trp5 ... His94 <-> Bridging ionZn262 <-> His119 ... Gln137 <-> Bridging ionHg263 <-> Cys206 ... Chain closurePhe260 <-> Trp5	probabilistic	color sequence
knots details	K +3₁	Trp5 ... His94 <-> Bridging ionZn262 <-> His96 ... Gln137 <-> Bridging ionHg263 <-> Glu205 ... Chain closurePhe260 <-> Trp5	probabilistic	color sequence
knots details	K +3₁	Trp5 ... His96 <-> Bridging ionZn262 <-> His119 ... Gln137 <-> Bridging ionHg263 <-> Glu205 ... Chain closurePhe260 <-> Trp5	probabilistic	color sequence
knots details	K +3₁	Trp5 ... His94 <-> Bridging ionZn262 <-> His119 ... Gln137 <-> Bridging ionHg263 <-> Glu205 ... Chain closurePhe260 <-> Trp5	probabilistic	color sequence

Chain Sequence

WGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAHLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASF

How to cite

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling