Warning
  • Chain breaks within knot chain part of loop (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
Cysteine knot
Loop Piercing
view details
30-c-48-b-90-c-75 19-b-68
Chain Sequence
EDWLTFQKKHITNTRDVDCDNIMSTNLFHCKDKNTFIYSRPEPVKAICKGIIASKNVLTTSEFYLSDCNVTSRPCKYKLK-STNKFCVTCENQAPVHFVGVGSC

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling