Warning
  • Chain breaks within knotoid 31 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
Cysteine knot
Loop Piercing
view details
43-c-47-b-114-c-112 14-b-80
Chain Sequence
KSSCKRHPLYVDFNLIGWGSWIIYPKQYNAYRCEGECPNPVGEEFHPTNHAYIQSLLKRYQPHRVPSTCCVPTELSAISMLYLDENEKVVLKNYQDMVVEGCGCR

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling