Warning
  • Chain breaks within knotoid 31 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
Cysteine knot
Loop Piercing
view details
4-c-11-b-23-c-21 17-b-29
Chain Sequence
GGVCPKILQRCRRDSDCPGACICRGNGYCGYPYDVPDYA

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling