Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
view details | +31 | 12-78 | 67 | 1-9, 294-301 | 10-11, 79-293 | 9 | 8 | slipknot |
Chain Sequence |
SPRYAQIPTFMRLPHDPQPRGYDVVVIGAPYDGGTSYRPGARFGPQAIRSESGLIHGVGIDRGPGTFDLINCVDAGDINLTPFDMNIAIDTAQSHLSGLLKANAAFLMIGGDHSLTVAALRAVAEQHGPLAVVHLDAHSDTNPAFYGGRYHHGTPFRHGIDEKLIDPAAMVQIGIRGH------LDYARGHGVRVVTADEFGELGVGGTADLIREKVGQRPVYVSVDIDVVDPAFAPGTGTPAPGGLLSREVLALLRCVGDLKPVGFDVMEVSPLYDHGGITSILATEIGAELLYQYARAH
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
view details | 2.1 | 14-78 | 65 | 1-7, 100-295 | 8-13, 79-99 | 7 | 196 | slipknot |
sequence length |
301
|
structure length |
295
|
publication title |
Oligomeric Structure of Proclavaminic Acid Amidino Hydrolase: Evolution of a Hydrolytic Enzyme in Clavulanic Acid Biosynthesis
pubmed doi rcsb |
molecule tags |
Hydrolase
|
molecule keywords |
PROCLAVAMINATE AMIDINO HYDROLASE
|
source organism |
Streptomyces clavuligerus
|
missing residues |
179-184
|
total genus |
Genus: 109
|
ec nomenclature |
ec
3.5.3.22: Proclavaminate amidinohydrolase. |
pdb deposition date | 2001-11-20 |
KnotProt deposition date | 2014-10-08 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 3-Layer(aba) Sandwich | Arginase; Chain A | Arginase; Chain A |
#chains in the KnotProt database with same CATH superfamily 1GQ7 A; 1GQ6 A; 1WOI A; 1WOG A; 1WOH A; 4DZ4 A; #chains in the KnotProt database with same CATH topology 1GQ7 A; 1GQ6 A; 1WOI A; 1WOG A; 1WOH A; 4DZ4 A; #chains in the KnotProt database with same CATH homology 1GQ7 A; 1GQ6 A; 1WOI A; 1WOG A; 1WOH A; 4DZ4 A;
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...