2WSWA

Crystal structure of carnitine transporter from proteus mirabilis
Slipknot S +31 41 +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 142-337 196 338-508 1-105 106-141 105 170 slipknot
view details
41 103-372 270 1-102 426-508 373-425 102 83 slipknot
Chain Sequence
AARGSHMKDNKKAGIEPKVFFPPLIIVGILCWLTVRDLDASNEVINAVFSYVTNVWGWAFEWYMVIMFGGWFWLVFGRYAKKRLGDEKPEFSTASWIFMMFASCTSAAVLFWGSIEIYYYISSPPFGMEGYSAPAKEIGLAYSLFHWGPLPWATYSFLSVAFAYFFFVRKMEVIRPSSTLVPLVGEKHVNGLFGTVVDNFYLVALILAMGTSLGLATPLVTECIQYLFGIPHTLQLDAIIISCWILLNAICVAFGLQKGVKIASDVRTYLSFLMLGWVFIVGGASFIVNYFTDSVGTLLMYMPRMLFYTDPIGKGGFPQAWTVFYWAWWVIYAIQMSIFLARISKGRTVRELCLGMVSGLTAGTWLIWTILGGNTLQLIDQNILNIPQLIDQYGVPRAIIETWAALPLSTATMWGFFILCFIATVTLINACSYTLAMSTCRSMKEGADPPLLVRIGWSVLVGIIGIILLALGGLKPIQTAIIAGGCPLFFVNIMVTLSFIKDAKVHWK
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5



Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
4.1 57-374 318 1-56 418-508 375-417 56 91 slipknot
view details
3.2 66-363 298 1-24, 376-508 25-65, 364-375 24 133 slipknot
view details
3.2 66-375 310 1-57, 378-508 58-65, 376-377 57 131 slipknot
view details
4.1 88-375 288 1-53, 419-508 54-87, 376-418 53 90 slipknot
view details
4.1 101-373 273 1-65, 411-508 66-100, 374-410 65 98 slipknot
view details
4.1 101-410 310 1-87, 416-508 88-100, 411-415 87 93 slipknot
view details
4.1 101-415 315 1-87, 419-508 88-100, 416-418 87 90 slipknot
view details
3.2 101-418 318 1-87, 423-508 88-100, 419-422 87 86 slipknot
view details
3.2 107-398 292 1-100, 419-508 101-106, 399-418 100 90 slipknot
view details
3.2 107-418 312 1-100, 423-508 101-106, 419-422 100 86 slipknot
view details
3.2 111-398 288 1-106, 419-508 107-110, 399-418 106 90 slipknot
view details
2.1 127-427 301 1-104, 475-508 105-126, 428-474 104 34 slipknot
view details
2.1 138-355 218 1-116, 374-508 117-137, 356-373 116 135 slipknot
view details
3.1 139-434 296 1-126, 455-508 127-138, 435-454 126 54 slipknot
view details
3.1 138-342 205 1-125, 356-508 126-137, 343-355 125 153 slipknot
view details
2.1 139-355 217 1-137, 370-508 138-138, 356-369 137 139 slipknot
view details
2.1 140-329 190 1-126, 342-508 127-139, 330-341 126 167 slipknot
view details
3.1 140-341 202 1-126, 356-508 127-139, 342-355 126 153 slipknot
view details
3.1 140-356 217 1-138, 359-508 139-139, 357-358 138 150 slipknot
view details
2.1 148-427 280 1-131, 482-508 132-147, 428-481 131 27 slipknot
view details
3.1 148-481 334 1-131, 485-508 132-147, 482-484 131 24 slipknot
view details
2.1 150-446 297 1-147, 485-508 148-149, 447-484 147 24 slipknot
view details
2.1 149-488 340 489-508 1-136 137-148 136 19 slipknot
sequence length 508
structure length 508
publication title Structural Basis of Na(+)-Independent and Cooperative Substrate/Product Antiport in Cait.
pubmed doi rcsb
molecule tags Transport protein
molecule keywords BCCT FAMILY BETAINE/CARNITINE/CHOLINE TRANSPORTER
ec nomenclature
pdb deposition date 2009-09-10
KnotProt deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02028 BCCT BCCT family transporter
Image from the rcsb pdb (www.rcsb.org)
2WSWA 4M8JA 3HFXA 2WSXA
similar chains in the KnotProt database (40% sequence similarity)
2WSXB 2WSXC
similar chains in the pdb database (40% sequence similarity)

 
            
               
#similar chains in the KnotProt database (40% sequence similarity)
 2WSW A;  4M8J A;  3HFX A;  2WSX A; 
               
               
           
#similar chains in the pdb database (40% sequence similarity)
 2WSX B;  2WSX C; 
           

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling