2WSWA

Crystal structure of carnitine transporter from proteus mirabilis
Slipknot S +31 41 +31
Knot core rangeKnot core lengthKnot tails rangeSlipknot tails rangeSlipknot loops rangeN-end lengthC-end lengthType
view details
+31 142-337 196 338-508 1-105 106-141 105 170 slipknot
view details
41 103-372 270 1-102 426-508 373-425 102 83 slipknot
Chain Sequence
AARGSHMKDNKKAGIEPKVFFPPLIIVGILCWLTVRDLDASNEVINAVFSYVTNVWGWAFEWYMVIMFGGWFWLVFGRYAKKRLGDEKPEFSTASWIFMMFASCTSAAVLFWGSIEIYYYISSPPFGMEGYSAPAKEIGLAYSLFHWGPLPWATYSFLSVAFAYFFFVRKMEVIRPSSTLVPLVGEKHVNGLFGTVVDNFYLVALILAMGTSLGLATPLVTECIQYLFGIPHTLQLDAIIISCWILLNAICVAFGLQKGVKIASDVRTYLSFLMLGWVFIVGGASFIVNYFTDSVGTLLMYMPRMLFYTDPIGKGGFPQAWTVFYWAWWVIYAIQMSIFLARISKGRTVRELCLGMVSGLTAGTWLIWTILGGNTLQLIDQNILNIPQLIDQYGVPRAIIETWAALPLSTATMWGFFILCFIATVTLINACSYTLAMSTCRSMKEGADPPLLVRIGWSVLVGIIGIILLALGGLKPIQTAIIAGGCPLFFVNIMVTLSFIKDAKVHWK
sequence length 508
structure length 508
publication title Structural Basis of Na(+)-Independent and Cooperative Substrate/Product Antiport in Cait.
pubmed doi rcsb
molecule tags Transport protein
molecule keywords BCCT FAMILY BETAINE/CARNITINE/CHOLINE TRANSPORTER
ec nomenclature
pdb deposition date2009-09-10
KnotProt deposition date2014-07-31

pfam database annotations

chain Pfam Accession CodePfam Family IdentifierPfam Description
A PF02028 BCCTBCCT family transporter
Image from the rcsb pdb (www.rcsb.org)
2WSWA 4M8JA 3HFXA 2WSXA
similar chains in the KnotProt database (40% sequence similarity)
2WSXB 2WSXC
similar chains in the pdb database (40% sequence similarity)

 
            
               
#similar chains in the KnotProt database (40% sequence similarity)
 2WSW A;  4M8J A;  3HFX A;  2WSX A; 
               
               
           
#similar chains in the pdb database (40% sequence similarity)
 2WSX B;  2WSX C; 
           

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling