3IEFA

Crystal structure of trna guanine-n1-methyltransferase from bartonella henselae using mpcs.
Knot K +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 84-127 44 1-83, 128-229 83 102 knot
Chain Sequence
KFQARVLTLYPEMFPGFLGCSLAGQALKQGIWSLETVQIRDFA-----SVDDTPAGGGAGMVMRADVLAAALDSCPNDSPRLLMSPRGRLLNQAYARSLARSSGVTLVCGRFEGVDERIIEARELEEVSIGDYILSGGETAALVLLDAIVRLLPGVMGNEISAKCESFENGLLEHPQYTRPAVFEGRGIPPVLTSGHHKAIANWRQQQAESLTRQRRPDLYALYNKNRQ
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 78-123 46 1-77, 124-224 77 101 knot
missing residues 44-48
publication title Crystal structure of tRNA guanine-n1-methyltransferase from Bartonella henselae using MPCS.
rcsb
structure length 224
molecule tags Transferase, rna binding protein
source organism Bartonella henselae
sequence length 229
molecule keywords tRNA (guanine-N(1)-)-methyltransferase
ec nomenclature ec 2.1.1.228: tRNA (guanine(37)-N(1))-methyltransferase.
pdb deposition date 2009-07-22
KnotProt deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01746 tRNA_m1G_MT tRNA (Guanine-1)-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1270.20 Mainly Alpha Orthogonal Bundle Trp Operon Repressor; Chain A tRNA(m1g37)methyltransferase, domain 2 3iefA02
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 3iefA01
3KTYA 1K3RA 3KY7A 1VHKA 1UALA 1GZ0A 3IEFA 3AI9X 3KNUA 1UAJA 1ZJRA 3NK6A 2QMMA 2HA8A 3E5YA 1X7OA 1J85A 1NS5A 3ONPA 3IC6A 3NK7A 1UAMA 3AXZA 3GYQA 1NXZA 2Z0YA 3L8UA 4E8BA 3ILKA 3DCMX 3N4KA 4IG6A 1VHYA 2CX8A 3N4JA 3AIAA 1MXIA 4H3ZA 2I6DA 1X7PA 2O3AA 1P9PA 2YY8A 1V6ZA 3QUVA 4FAKA 1TO0A 1O6DA 2QWVA 1V2XA 4H3YA 1VH0A 1IPAA 1UAKA
chains in the KnotProt database with same CATH superfamily
3KTYA 1K3RA 3KY7A 1VHKA 1UALA 1GZ0A 3IEFA 3AI9X 3KNUA 1UAJA 1ZJRA 3NK6A 2QMMA 2HA8A 3E5YA 1X7OA 1J85A 1NS5A 3ONPA 3IC6A 3NK7A 1UAMA 3AXZA 3GYQA 1NXZA 2Z0YA 3L8UA 4E8BA 3ILKA 3DCMX 3N4KA 4IG6A 1VHYA 2CX8A 3N4JA 3AIAA 1MXIA 4H3ZA 2I6DA 1X7PA 2O3AA 1P9PA 2YY8A 1V6ZA 3QUVA 4FAKA 1TO0A 1O6DA 2QWVA 1V2XA 4H3YA 1VH0A 1IPAA 1UAKA
chains in the KnotProt database with same CATH topology
3KTYA 1K3RA 3KY7A 1VHKA 1UALA 1GZ0A 3IEFA 3AI9X 3KNUA 1UAJA 1ZJRA 3NK6A 2QMMA 2HA8A 3E5YA 1X7OA 1J85A 1NS5A 3ONPA 3IC6A 3NK7A 1UAMA 3AXZA 3GYQA 1NXZA 2Z0YA 3L8UA 4E8BA 3ILKA 3DCMX 3N4KA 4IG6A 1VHYA 2CX8A 3N4JA 3AIAA 1MXIA 4H3ZA 2I6DA 1X7PA 2O3AA 1P9PA 2YY8A 1V6ZA 3QUVA 4FAKA 1TO0A 1O6DA 2QWVA 1V2XA 4H3YA 1VH0A 1IPAA 1UAKA
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 3KTY A;  1K3R A;  3KY7 A;  1VHK A;  1UAL A;  1GZ0 A;  3IEF A;  3AI9 X;  3KNU A;  1UAJ A;  1ZJR A;  3NK6 A;  2QMM A;  2HA8 A;  3E5Y A;  1X7O A;  1J85 A;  1NS5 A;  3ONP A;  3IC6 A;  3NK7 A;  1UAM A;  3AXZ A;  3GYQ A;  1NXZ A;  2Z0Y A;  3L8U A;  4E8B A;  3ILK A;  3DCM X;  3N4K A;  4IG6 A;  1VHY A;  2CX8 A;  3N4J A;  3AIA A;  1MXI A;  4H3Z A;  2I6D A;  1X7P A;  2O3A A;  1P9P A;  2YY8 A;  1V6Z A;  3QUV A;  4FAK A;  1TO0 A;  1O6D A;  2QWV A;  1V2X A;  4H3Y A;  1VH0 A;  1IPA A;  1UAK A; 
#chains in the KnotProt database with same CATH topology
 3KTY A;  1K3R A;  3KY7 A;  1VHK A;  1UAL A;  1GZ0 A;  3IEF A;  3AI9 X;  3KNU A;  1UAJ A;  1ZJR A;  3NK6 A;  2QMM A;  2HA8 A;  3E5Y A;  1X7O A;  1J85 A;  1NS5 A;  3ONP A;  3IC6 A;  3NK7 A;  1UAM A;  3AXZ A;  3GYQ A;  1NXZ A;  2Z0Y A;  3L8U A;  4E8B A;  3ILK A;  3DCM X;  3N4K A;  4IG6 A;  1VHY A;  2CX8 A;  3N4J A;  3AIA A;  1MXI A;  4H3Z A;  2I6D A;  1X7P A;  2O3A A;  1P9P A;  2YY8 A;  1V6Z A;  3QUV A;  4FAK A;  1TO0 A;  1O6D A;  2QWV A;  1V2X A;  4H3Y A;  1VH0 A;  1IPA A;  1UAK A; 
#chains in the KnotProt database with same CATH homology
 3KTY A;  1K3R A;  3KY7 A;  1VHK A;  1UAL A;  1GZ0 A;  3IEF A;  3AI9 X;  3KNU A;  1UAJ A;  1ZJR A;  3NK6 A;  2QMM A;  2HA8 A;  3E5Y A;  1X7O A;  1J85 A;  1NS5 A;  3ONP A;  3IC6 A;  3NK7 A;  1UAM A;  3AXZ A;  3GYQ A;  1NXZ A;  2Z0Y A;  3L8U A;  4E8B A;  3ILK A;  3DCM X;  3N4K A;  4IG6 A;  1VHY A;  2CX8 A;  3N4J A;  3AIA A;  1MXI A;  4H3Z A;  2I6D A;  1X7P A;  2O3A A;  1P9P A;  2YY8 A;  1V6Z A;  3QUV A;  4FAK A;  1TO0 A;  1O6D A;  2QWV A;  1V2X A;  4H3Y A;  1VH0 A;  1IPA A;  1UAK A; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling