| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
+31 | 84-136 | 53 | 1-83, 137-170 | 83 | 34 | knot |
Chain Sequence |
DPALRALQNIRIVLVETSHTGNMGSVARAMKTMGLTNLWLVNPLVKPD-------AGASDVIGNAHIVDTLDEALAGCSLVVGTSARSRTLPWPMLDPRECGLKSVAEAANTPVALVFGRERVGLTNEELQKCHYHVAIAANPEYSSLNLAMAVQVIAYEVRMAWLATQ
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
3.1 | 76-129 | 54 | 1-75, 130-162 | 75 | 33 | knot | ||||
| view details |
|
 |
2.1 | 31-126 | 96 | 1-30 | 132-162 | 127-131 | 30 | 31 | slipknot |
| sequence length |
169
|
| structure length |
162
|
| publication title |
Characterization of Two Homologous 2'-O-Methyltransferases Showing Different Specificities for Their tRNA Substrates.
pubmed doi rcsb |
| molecule tags |
Transferase
|
| molecule keywords |
TRNA (CYTIDINE/URIDINE-2'-O-)-METHYLTRANSFERASE TRMJ
|
| source organism |
Escherichia coli
|
| missing residues |
49-55
|
| ec nomenclature |
ec
2.1.1.200: tRNA (cytidine(32)/uridine(32)-2'-O)-methyltransferase. |
| pdb deposition date | 2014-01-22 |
| KnotProt deposition date | 2018-09-16 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| B | PF00588 | SpoU_methylase | SpoU rRNA Methylase family |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
