4MHXB

Crystal structure of sulfamidase
Slipknot S +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 4-252 249 1-3 271-482 253-270 3 212 slipknot
Chain Sequence
PRNALLLLADDGGFESGAYNNSAIATPHLDALARRSLLFRNAFTSVSSXSPSRASLLTGLPQHQNGMYGLHQDVHHFNSFDKVRSLPLLLSQAGVRTGIIGKKHVGPETVYPFDFAYTEENGSVLQVGRNITRIKLLVRKFLQTQDDRPFFLYVAFHDPHRCGHSQPQYGTFCEKFGNGESGMGRIPDWTPQAYDPLDVLVPYFVPNTPAARADLAAQYTTVGRMDQGVGLVLQELRDAGVLNDTLVIFTSDNGIPFPSGRTNLYWPGTAEPLLVSSPEHPKRWGQVSEAYVSLLDLTPTILDWFSIPYPSYAIFGSKTIHLTGRSLLPALEAEPLWATVFGSQSHHEVTMSYPMRSVQHRHFRLVHNLNFKMPFPIDQDFYVSPTFQDLLNRTTAGQPTGWYKDLRHYYYRARWELYDRSRDPHETQNLATDPRFAQLLEMLRDQLAKWQWETHDPWVCAPDGVLEEKLSPQCQPLHNELR
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 4-256 253 1-3 270-482 257-269 3 213 slipknot
view details
3.1 6-263 258 1-3, 267-482 4-5, 264-266 3 216 slipknot
publication title Structure of sulfamidase provides insight into the molecular pathology of mucopolysaccharidosis IIIA
rcsb
structure length 482
molecule tags Hydrolase
source organism Homo sapiens
sequence length 482
molecule keywords N-sulphoglucosamine sulphohydrolase
ec nomenclature ec 3.10.1.1: N-sulfoglucosamine sulfohydrolase.
pdb deposition date 2013-08-30
KnotProt deposition date 2014-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00884 Sulfatase Sulfatase
Image from the rcsb pdb (www.rcsb.org)
4MHXA 4MHXB 4MIVA 4MIVB 4MIVC 4MIVD 4MIVE 4MIVF 4MIVG 4MIVH
similar chains in the KnotProt database (40% sequence similarity)

 
            
               
#similar chains in the KnotProt database (40% sequence similarity)
 4MHX A;  4MHX B;  4MIV A;  4MIV B;  4MIV C;  4MIV D;  4MIV E;  4MIV F;  4MIV G;  4MIV H; 
               
               
           

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling