4X08A

Structure of h128n/ecp mutant in complex with sulphate anions at 1.34 angstroms.
Cysteine knot
Loop Piercing
view details
37-c-55-b-111-c-96 23-b-83
Chain Sequence
RPPQFTRAQWFAIQHISLNPPRCTIAMRAINNYRWRCKNQNTFLRTTFANVVNVCGNQSIRCPHNRTLNNCHRSRFRVPLLHCDLINPGAQNISNCRYADRPGRRFYVVACDNRDPRDSPRYPVVPVNLDTTI
sequence length 133
structure length 133
publication title Structure of H128N/ECP mutant in complex with sulphate anions at 1.34 Angstroms.
rcsb
molecule tags Hydrolase
molecule keywords Eosinophil cationic protein
source organism Homo sapiens
ec nomenclature ec 3.1.27.-:
ec 3.1.27.5: Pancreatic ribonuclease.
pdb deposition date 2014-11-21
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling