5BQBD

Crystal structure of norrin, a wnt signalling activator, crystal form iii
Cysteine knot
Loop Piercing
view details
39-c-55-b-110-c-96 65-b-126
Chain Sequence
PRRCMRHHYVDSISHPLYKCSSKMVLLARCEGHCSQASRSEPLVSFSTVLKQPFRSSCHCCRPQTSKLKALRLRCSGGMRLTATYRYILSCHCEECNS
sequence length 98
structure length 98
publication title Structure and functional properties of Norrin mimic Wnt for signalling with Frizzled4, Lrp5/6, and proteoglycan.
pubmed doi rcsb
molecule tags Signaling protein
molecule keywords Norrin
source organism Homo sapiens
ec nomenclature
pdb deposition date 2015-05-28
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling