| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 39-c-55-b-110-c-96 | 65-b-126 |
Chain Sequence |
DSDPRRCMRHHYVDSISHPLYKCSSKMVLLARCEGHCSQASRSEPLVSFSTVLKQPFRSSCHCCRPQTSKLKALRLRCSGGMRLTATYRYILSCHCEECNS
|
| sequence length |
101
|
| structure length |
101
|
| publication title |
Structure and functional properties of Norrin mimic Wnt for signalling with Frizzled4, Lrp5/6, and proteoglycan.
pubmed doi rcsb |
| molecule tags |
Signaling protein
|
| molecule keywords |
Norrin
|
| source organism |
Homo sapiens
|
| ec nomenclature | |
| pdb deposition date | 2015-05-28 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
