5GM6J

Cryo-em structure of the activated spliceosome (bact complex) at 3.5 angstrom resolution
Knot K -31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
-31 19-68 50 1-18, 69-103 18 35 knot
Chain Sequence
SRHQFDLIMCLKQPGVQTGLLCEKCDGKCPICDSYVRPKRKVRVCENCSFGKQAKNCIICNLNVGVNDAFYCWECCRLGKDKDGCPRILNLGSNRLDRHFEKK
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5



Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1m 19-71 53 1-18, 72-103 18 32 knot
sequence length 103
structure length 103
publication title Structure of a yeast activated spliceosome at 3.5 angstrom resolution
pubmed doi rcsb
molecule tags Rna binding protein/rna
molecule keywords Pre-mRNA-splicing factor 8
ec nomenclature
pdb deposition date 2016-07-12
KnotProt deposition date 2016-10-22
Image from the rcsb pdb (www.rcsb.org)
5SYBA 5IFED 5LQWY 5GM6J 2K0AA
similar chains in the KnotProt database (40% sequence similarity)
5SYBB 6EN4D 5O9Zy 5NRLS
similar chains in the pdb database (40% sequence similarity)

 
            
               
#similar chains in the KnotProt database (40% sequence similarity)
 5SYB A;  5IFE D;  5LQW Y;  5GM6 J;  2K0A A; 
               
               
           
#similar chains in the pdb database (40% sequence similarity)
 5SYB B;  6EN4 D;  5O9Z y;  5NRL S; 
           

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling