5GM8A

Methylation at position 32 of trna catalyzed by trmj alters oxidative stress response in pseudomonas aeruiginosa
Knot K +31
Knot core rangeKnot core lengthKnot tails rangeSlipknot tails rangeSlipknot loops rangeN-end lengthC-end lengthType
view details
+31 82-135 54 1-81, 136-170 81 35 knot
Chain Sequence
QSMMLDRIRVVLVNTSHPGNIGGAARAMKNMGLSQLVLVQPESFPHGDAVARASGATDILDAARVVDTLEEALSGCSVVLGTSARDRRIPWPLLDPRECATTCLEHLEANGEVALVFGREYAGLTNEELQRCQFHVHIPSDPEFGSLNLAAAVQVLTYEVRMAWLAAQGK
sequence length 170
structure length 170
publication title Methylation at position 32 of tRNA catalyzed by TrmJ alters oxidative stress response in Pseudomonas aeruiginosa
rcsb
molecule tags Transferase
molecule keywords tRNA (cytidine/uridine-2'-O-)-methyltransferase TrmJ
source organism Pseudomonas aeruginosa
ec nomenclature
pdb deposition date2016-07-13
KnotProt deposition date2016-10-28
Image from the rcsb pdb (www.rcsb.org)
5GMBA 5GMCA 5GM8A 3KTYA
similar chains in the KnotProt database (40% sequence similarity)
5GMCB 5GMCC 5GMCD 5GM8B 5GM8C 5GM8D 3KTYB 3KTYC
similar chains in the pdb database (40% sequence similarity)

 
            
               
#similar chains in the KnotProt database (40% sequence similarity)
 5GMB A;  5GMC A;  5GM8 A;  3KTY A; 
               
               
           
#similar chains in the pdb database (40% sequence similarity)
 5GMC B;  5GMC C;  5GMC D;  5GM8 B;  5GM8 C;  5GM8 D;  3KTY B;  3KTY C; 
           

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling