5GRAA

Crystal structure of trmj from z. mobilis zm4
Knot K +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 78-127 50 1-77, 128-232 77 105 knot
Chain Sequence
AVPAIILVRPQLGENIGKAARAMLNFGLDDLRLVAPRDGWPNPSAGPAASGADRVLQQARVFPTVAEAVADCAHVYATTVRKRGVTKPVMTPEQAAQTIHEQEGGVGILFGPERAGLETDDVALARTIITVPVNPEFSSLNLAQAVILVAYEWSKGQ--------DMEPPAPQEELEAMIGHLENMLDKNGYFFPIPRIPTIKRTLRTLLTKPSWNSMEIRTLRGVLSTLEK
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 77-129 53 1-76, 130-224 76 95 knot
view details
2.1 68-126 59 1-25, 130-224 26-67, 127-129 25 95 slipknot
view details
2.1 79-208 130 1-76, 219-224 77-78, 209-218 76 6 slipknot
missing residues 158-165
publication title An asymmetric dimeric structure of TrmJ tRNA methyltransferase from Zymomonas mobilis with a flexible C-terminal dimer
pubmed doi rcsb
structure length 224
molecule tags Transferase
source organism Zymomonas mobilis subsp. mobilis zm4 = atcc 31821
sequence length 232
molecule keywords tRNA (cytidine/uridine-2'-O-)-methyltransferase TrmJ
ec nomenclature
pdb deposition date 2016-08-09
KnotProt deposition date 2017-06-21
Image from the rcsb pdb (www.rcsb.org)
3ONPA 5GRAA
similar chains in the KnotProt database (40% sequence similarity)
5GRAB
similar chains in the pdb database (40% sequence similarity)

 
            
               
#similar chains in the KnotProt database (40% sequence similarity)
 3ONP A;  5GRA A; 
               
               
           
#similar chains in the pdb database (40% sequence similarity)
 5GRA B; 
           

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling