5GRAA

Crystal structure of trmj from z. mobilis zm4
Knot K +31
Knot core rangeKnot core lengthKnot tails rangeSlipknot tails rangeSlipknot loops rangeN-end lengthC-end lengthType
view details
+31 78-127 50 1-77, 128-232 77 105 knot
Chain Sequence
AVPAIILVRPQLGENIGKAARAMLNFGLDDLRLVAPRDGWPNPSAGPAASGADRVLQQARVFPTVAEAVADCAHVYATTVRKRGVTKPVMTPEQAAQTIHEQEGGVGILFGPERAGLETDDVALARTIITVPVNPEFSSLNLAQAVILVAYEWSKGQ--------DMEPPAPQEELEAMIGHLENMLDKNGYFFPIPRIPTIKRTLRTLLTKPSWNSMEIRTLRGVLSTLEK
sequence length 232
structure length 224
publication title An asymmetric dimeric structure of TrmJ tRNA methyltransferase from Zymomonas mobilis with a flexible C-terminal dimer
pubmed doi rcsb
molecule tags Transferase
molecule keywords tRNA (cytidine/uridine-2'-O-)-methyltransferase TrmJ
source organism Zymomonas mobilis subsp. mobilis zm4 = atcc 31821
missing residues 158-165
ec nomenclature
pdb deposition date2016-08-09
KnotProt deposition date2017-06-21
Image from the rcsb pdb (www.rcsb.org)
3ONPA 5GRAA
similar chains in the KnotProt database (40% sequence similarity)
5GRAB
similar chains in the pdb database (40% sequence similarity)

 
            
               
#similar chains in the KnotProt database (40% sequence similarity)
 3ONP A;  5GRA A; 
               
               
           
#similar chains in the pdb database (40% sequence similarity)
 5GRA B; 
           

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling