5HWYA

Structural mechanisms of extracellular ion exchange and induced binding-site occlusion in the sodium-calcium exchanger ncx_mj soaked with 10 mm na+ and zero ca2+
Knot K +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 44-230 187 1-43, 231-300 43 70 knot
Chain Sequence
MVILGVGYFLLGLILLYYGSDWFVLGSERIARHFNVSNFVIGATVMAIGTSLPEILTSAYASYMHAPGISIGNAIGSCICNIGLVLGLSAIISPIIVDKNLQKNILVYLLFVIFAAVIGIDGFSWIDGVVLLILFIIYLRWTVKNGSAEIEENNDKNNPSVVFSLVLLIIGLIGVLVGAELFVDGAKKIALALDISDKVIGFTLVAFGTSLPELMVSLAAAKRNLGGMVLGNVIGSNIADIGGALAVGSLFMHLPAENVQMAVLVIMSLLLYLFAKYSKIGRWQGILFLALYIIAIASLR
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5



Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
2.1 21-248 228 1-20, 249-300 20 52 knot
view details
3.1 18-236 219 1-4, 249-300 5-17, 237-248 4 52 slipknot
view details
2.1 28-248 221 1-20, 281-300 21-27, 249-280 20 20 slipknot
view details
3.1 28-280 253 1-20, 285-300 21-27, 281-284 20 16 slipknot
view details
3.1 28-284 257 285-300 1-20 21-27 20 15 slipknot
view details
2.1 38-244 207 245-300 1-17 18-37 17 55 slipknot
view details
2.1 40-239 200 1-17, 269-300 18-39, 240-268 17 32 slipknot
view details
2.1 40-268 229 269-300 1-37 38-39 37 31 slipknot
view details
2.1 44-244 201 245-300 1-39 40-43 39 55 slipknot
view details
2.1 47-241 195 1-39, 269-300 40-46, 242-268 39 32 slipknot
view details
2.1 47-268 222 269-300 1-43 44-46 43 31 slipknot
sequence length 300
structure length 300
publication title Mechanism of extracellular ion exchange and binding-site occlusion in the sodium-calcium exchanger
doi rcsb
molecule tags Membrane protein
molecule keywords Uncharacterized membrane protein MJ0091
source organism Methanocaldococcus jannaschii (strain atcc 43067 / dsm 2661 / jal-1 / jcm 10045 / nbrc 100440)
ec nomenclature
pdb deposition date 2016-01-29
KnotProt deposition date 2016-05-22
Image from the rcsb pdb (www.rcsb.org)
3V5UA 5HWYA 3V5SA
similar chains in the KnotProt database (40% sequence similarity)
5HYAA 5HXCA 5JDHA 5HXEA 5JDNA 5JDGA 5HWXA 5JDQA 5HXRA 5JDMA 5JDFA 5HXHA 5HXHB 5HXSA 5JDLA
similar chains in the pdb database (40% sequence similarity)

 
            
               
#similar chains in the KnotProt database (40% sequence similarity)
 3V5U A;  5HWY A;  3V5S A; 
               
               
           
#similar chains in the pdb database (40% sequence similarity)
 5HYA A;  5HXC A;  5JDH A;  5HXE A;  5JDN A;  5JDG A;  5HWX A;  5JDQ A;  5HXR A;  5JDM A;  5JDF A;  5HXH A;  5HXH B;  5HXS A;  5JDL A; 
           

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling