5IFED

Crystal structure of the human sf3b core complex
Knot K -31
Knot core rangeKnot core lengthKnot tails rangeSlipknot tails rangeSlipknot loops rangeN-end lengthC-end lengthType
view details
-31 16-62 47 1-15, 63-89 15 27 knot
Chain Sequence
DLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSK
sequence length 89
structure length 89
publication title Molecular Architecture of SF3b and Structural Consequences of Its Cancer-Related Mutations.
pubmed doi rcsb
molecule tags Splicing
molecule keywords Splicing factor 3B subunit 5
source organism Homo sapiens
ec nomenclature
pdb deposition date2016-02-25
KnotProt deposition date2016-10-30
Image from the rcsb pdb (www.rcsb.org)
5SYBA 5IFED 5LQWY 5GM6J 2K0AA
similar chains in the KnotProt database (40% sequence similarity)
5SYBB 5O9Zy 5NRLS
similar chains in the pdb database (40% sequence similarity)

 
            
               
#similar chains in the KnotProt database (40% sequence similarity)
 5SYB A;  5IFE D;  5LQW Y;  5GM6 J;  2K0A A; 
               
               
           
#similar chains in the pdb database (40% sequence similarity)
 5SYB B;  5O9Z y;  5NRL S; 
           

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling