5IFED

Crystal structure of the human sf3b core complex
Knot K -31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
-31 16-62 47 1-15, 63-89 15 27 knot
Chain Sequence
DLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSK
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5



Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1m 14-81 68 1-13, 82-89 13 8 knot
view details
3.1m 13-64 52 1-12 82-89 65-81 12 8 slipknot
sequence length 89
structure length 89
publication title Molecular Architecture of SF3b and Structural Consequences of Its Cancer-Related Mutations.
pubmed doi rcsb
molecule tags Splicing
molecule keywords Splicing factor 3B subunit 5
source organism Homo sapiens
ec nomenclature
pdb deposition date 2016-02-25
KnotProt deposition date 2016-10-30
Image from the rcsb pdb (www.rcsb.org)
5SYBA 5IFED 5LQWY 5GM6J 2K0AA
similar chains in the KnotProt database (40% sequence similarity)
5SYBB 6EN4D 5O9Zy 5NRLS
similar chains in the pdb database (40% sequence similarity)

 
            
               
#similar chains in the KnotProt database (40% sequence similarity)
 5SYB A;  5IFE D;  5LQW Y;  5GM6 J;  2K0A A; 
               
               
           
#similar chains in the pdb database (40% sequence similarity)
 5SYB B;  6EN4 D;  5O9Z y;  5NRL S; 
           

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling