5JAGA

Leut t354h mutant in the outward-oriented, na+-free return state
Warning
  • Chain breaks within knot 31 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
  • Chain breaks within knot 41 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
Slipknot S +31 41
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 38-262 225 263-504 1-17 18-37 17 241 slipknot
view details
41 14-295 282 1-13 350-504 296-349 13 155 slipknot
Chain Sequence
KREHWATRLGLILAMAGNAVGLGNFLRFPVQAAENGGGAFMIPYIIAFLLVGIPLMWIEWAMGRYGGAQGHGTTPAIFYLLWRNRFAKILGVFGLWIPLVVAIYYVYIESWTLGFAIKFLVGLVPEPP---TDPDSILRPFKEFLYSYIGVPKGDEPILKPSLFAYIVFLITMFINVSILIRGISKGIERFAKIAMPTLFILAVFLVIRVFLLETPNGTAADGLNFLWTPDFEKLKDPGVWIAAVGQIFFTLSLGFGAIITYASYVRKDQDIVLSGLTAATLNEKAEVILGGSISIPAAVAFFGVANAVAIAKAGAFNLGFITLPAIFSQTAGGTFLGFLWFFLLFFAGLHSSIAIMQPMIAFLEDELKLSRKHAVLWTAAIVFFSAHLVMFLNKSLDEMDFWAGTIGVVFFGLTELIIFFWIFGADKAWEEINRGGIIKVPRIYYYVMRYITPAFLAVLLVVWAREYIPTHW-----TVWITRFYIIGLFLFLTFLVFLAERR
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5



Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.2 14-286 273 1-13 301-496 287-300 13 196 slipknot
view details
3.2 11-300 290 1-10 309-496 301-308 10 188 slipknot
view details
4.1 8-312 305 1-7 318-496 313-317 7 179 slipknot
view details
3.2 16-330 315 1-15 349-496 331-348 15 148 slipknot
view details
4.1 12-300 289 1-10, 309-496 11-11, 301-308 10 188 slipknot
view details
3.2m 14-319 306 1-8, 327-496 9-13, 320-326 8 170 slipknot
view details
2.1 43-357 315 1-17, 400-496 18-42, 358-399 17 97 slipknot
view details
2.1 23-475 453 1-17, 485-496 18-22, 476-484 17 12 slipknot
view details
2.1 42-409 368 410-496 1-18 19-41 18 86 slipknot
view details
2.1 30-269 240 1-23, 276-496 24-29, 270-275 23 221 slipknot
view details
1.1 35-242 208 1-24, 255-496 25-34, 243-254 24 242 slipknot
view details
1.1 41-273 233 1-24, 291-496 25-40, 274-290 24 206 slipknot
view details
2.1 41-271 231 1-30, 274-496 31-40, 272-273 30 223 slipknot
view details
1.1 38-244 207 1-30, 257-496 31-37, 245-256 30 240 slipknot
view details
2.1 42-261 220 1-31, 276-496 32-41, 262-275 31 221 slipknot
sequence length 504
structure length 496
publication title A conserved leucine occupies the empty substrate site of LeuT in the Na(+)-free return state.
pubmed doi rcsb
molecule tags Transport protein
molecule keywords Transporter
source organism Aquifex aeolicus (strain vf5)
missing residues 129-131, 471-475
ec nomenclature
pdb deposition date 2016-04-12
KnotProt deposition date 2016-06-03
Image from the rcsb pdb (www.rcsb.org)
2A65A 2Q72A 3F3EA 2QEIA 2Q6HA 3GJDA 2QB4A 3F4IA 3F48A 3F3AA 3F3CA 3MPNA 3GWUA 3F4JA 3MPQA 3USPA 4MMBA 3F3DA 4MMCA 3GWVA 4MMDA 3GWWA 4MMEA 3USGA 3QS5A 5JAEA 4FXZA 4MMFA 5JAGA 3QS4A 3QS6A 3USLA 2QJUA 4MM7A 3GJCA 4FY0A 5JAFA 4MM4A 4HMKA 3USMA 3TU0A 4MM9A 4MM6A 4HODA 3TT1A 4MM5A 4MM8A 3USIA 4MMAA 3TT3A 3USJA 3USOA 3USKA
similar chains in the KnotProt database (40% sequence similarity)
4MMDB 4MMEB 5JAEB 4MMFB 3GJCB 4MM4B 4HMKB 3TT1B 3USIB 3USJB 3USOB 3USKB 3USKC 3USKD
similar chains in the pdb database (40% sequence similarity)

 
            
               
#similar chains in the KnotProt database (40% sequence similarity)
 2A65 A;  2Q72 A;  3F3E A;  2QEI A;  2Q6H A;  3GJD A;  2QB4 A;  3F4I A;  3F48 A;  3F3A A;  3F3C A;  3MPN A;  3GWU A;  3F4J A;  3MPQ A;  3USP A;  4MMB A;  3F3D A;  4MMC A;  3GWV A;  4MMD A;  3GWW A;  4MME A;  3USG A;  3QS5 A;  5JAE A;  4FXZ A;  4MMF A;  5JAG A;  3QS4 A;  3QS6 A;  3USL A;  2QJU A;  4MM7 A;  3GJC A;  4FY0 A;  5JAF A;  4MM4 A;  4HMK A;  3USM A;  3TU0 A;  4MM9 A;  4MM6 A;  4HOD A;  3TT1 A;  4MM5 A;  4MM8 A;  3USI A;  4MMA A;  3TT3 A;  3USJ A;  3USO A;  3USK A; 
               
               
           
#similar chains in the pdb database (40% sequence similarity)
 4MMD B;  4MME B;  5JAE B;  4MMF B;  3GJC B;  4MM4 B;  4HMK B;  3TT1 B;  3USI B;  3USJ B;  3USO B;  3USK B;  3USK C;  3USK D; 
           

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling