5LQWY

Yeast activated spliceosome
Warning
  • Chain breaks within knot 31 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
Knot K -31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
-31 17-65 49 1-16, 66-90 16 25 knot
Chain Sequence
FDLIMCLKQPGVQTGLLCEKCDGKCPICDSYVRPKRKVRVCENCSFGKQAKNCIICN-NVGVNDAFYCWECCRLGKDKDGCPRILNLGSN
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1m 15-73 59 1-14, 74-89 14 16 knot
view details
3.1m 13-65 53 1-12 74-89 66-73 12 16 slipknot
missing residues 58
publication title Molecular architecture of the Saccharomyces cerevisiae activated spliceosome
pubmed doi rcsb
structure length 89
molecule tags Splicing
source organism Saccharomyces cerevisiae
sequence length 90
molecule keywords Pre-mRNA-splicing factor 8
ec nomenclature
pdb deposition date 2016-08-17
KnotProt deposition date 2017-02-13
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling