5OSQA

Zp-n domain of mammalian sperm receptor zp3 (crystal form ii, processed in p21221)
Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K 12x +31

  Help Knotting data interpretation Full screen
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
+ 31 110-289 180 1-109, 290-377 109 88 knot
Fingerprint Knot forming loop Loop type
K +31
Chain closureThr3 <-> Leu474
... Asp437 <->
Bridging ionCa504
<-> Asp210 ... Gln366 <->
Bridging ionCa503
<-> Val182 ... Thr3		 probabilistic
K +31
Chain closureThr3 <-> Leu474
... Asp437 <->
Bridging ionCa504
<-> Asp210 ... Gln366 <->
Bridging ionCa503
<-> Asp185 ... Thr3		 probabilistic
K +31
Chain closureThr3 <-> Leu474
... Asp437 <->
Bridging ionCa504
<-> Ser212 ... Gln366 <->
Bridging ionCa503
<-> Val182 ... Thr3		 probabilistic
K +31
Chain closureThr3 <-> Leu474
... Asp437 <->
Bridging ionCa504
<-> Ser212 ... Gln366 <->
Bridging ionCa503
<-> Asp185 ... Thr3		 probabilistic
K +31
Chain closureThr3 <-> Leu474
... Cys469 <-> Cys376 ... Asp437 <->
Bridging ionCa504
<-> Asp210 ... Gln366 <->
Bridging ionCa503
<-> Val182 ... Thr3		 probabilistic
K +31
Chain closureThr3 <-> Leu474
... Cys469 <-> Cys376 ... Asp437 <->
Bridging ionCa504
<-> Asp210 ... Gln366 <->
Bridging ionCa503
<-> Asp185 ... Thr3		 probabilistic
K +31
Chain closureThr3 <-> Leu474
... Cys469 <-> Cys376 ... Asp437 <->
Bridging ionCa504
<-> Ser212 ... Gln366 <->
Bridging ionCa503
<-> Val182 ... Thr3		 probabilistic
K +31
Chain closureThr3 <-> Leu474
... Cys469 <-> Cys376 ... Asp437 <->
Bridging ionCa504
<-> Ser212 ... Gln366 <->
Bridging ionCa503
<-> Asp185 ... Thr3		 probabilistic
K +31
Chain closureThr3 <-> Leu474
... Cys469 <-> Cys376 ... Cys408 <-> Cys428 ... Asp437 <->
Bridging ionCa504
<-> Asp210 ... Gln366 <->
Bridging ionCa503
<-> Val182 ... Thr3		 probabilistic
K +31
Chain closureThr3 <-> Leu474
... Cys469 <-> Cys376 ... Cys408 <-> Cys428 ... Asp437 <->
Bridging ionCa504
<-> Asp210 ... Gln366 <->
Bridging ionCa503
<-> Asp185 ... Thr3		 probabilistic
K +31
Chain closureThr3 <-> Leu474
... Cys469 <-> Cys376 ... Cys408 <-> Cys428 ... Asp437 <->
Bridging ionCa504
<-> Ser212 ... Gln366 <->
Bridging ionCa503
<-> Val182 ... Thr3		 probabilistic
K +31
Chain closureThr3 <-> Leu474
... Cys469 <-> Cys376 ... Cys408 <-> Cys428 ... Asp437 <->
Bridging ionCa504
<-> Ser212 ... Gln366 <->
Bridging ionCa503
<-> Asp185 ... Thr3		 probabilistic
Chain Sequence
TEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDAALAAAQTNAAAVKVECLEAELVVTVSRDLFGTGKLVQPGDLTLGSEGCQPRVSVDTDVVRFNAQLHECSSRVQMTKDALVYSTFLLHDPRPVSGLSILRTNRVEVPIECRYPRL
sequence length 472
structure length 472
publication title Crystal structure of the ZP-N domain of ZP3 reveals the core fold of animal egg coats
pubmed doi rcsb
molecule tags Cell adhesion
molecule keywords Maltose-binding periplasmic protein,Zona pellucida sperm-binding protein 3
source organism Escherichia coli k-12
total genus Genus: 140
ec nomenclature
pdb deposition date 2017-08-18
KnotProt deposition date 2018-10-29
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

  
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...
How to cite
KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling