5TT3A

Crystal structure of the complex of helicobacter pylori alpha-carbonic anhydrase with ethoxzolamide
Warning
  • Chain breaks within knot 31 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
Knot K +31
Knot core rangeKnot core lengthKnot tails rangeSlipknot tails rangeSlipknot loops rangeN-end lengthC-end lengthType
view details
+31 31-219 189 1-30, 220-226 30 7 knot
Chain Sequence
KWDYKNKENGPHRWDKLHKDFEVCKSGKSQSPINIEHYYHTQDKADLQFKYAASKPKAVFFTHHTLKASFEPTNHINYRGHDYVLDNVHFHAPMEFLINNKTRPLSAHFVHKDAKGRLLVLAIGFEEGKENPNLDPILEGIQ---NFKEVALDAFLPKSINYYHFNGSLTAPPCTEGVAWFVIEEPLEVSAKQLAEIKKRMKNSPNQRPVQPDYNTVIIKSSAETR
sequence length 226
structure length 223
publication title Structure-Activity Relationship for Sulfonamide Inhibition of Helicobacter pylori alpha-Carbonic Anhydrase.
pubmed doi rcsb
molecule tags Lyase
molecule keywords Alpha-carbonic anhydrase
source organism Helicobacter pylori (strain atcc 700392 / 26695)
missing residues 143-145
ec nomenclature
pdb deposition date2016-11-01
KnotProt deposition date2017-09-13
Image from the rcsb pdb (www.rcsb.org)
4XFWA 5TT3A 5TUOA 4YGFA 4YHAA
similar chains in the KnotProt database (40% sequence similarity)
4XFWB 4YGFB 4YGFC 4YGFD 4YGFE 4YGFF 4YGFG 4YGFH 5TT3B 5TT3C 5TT3D 5TT3E 5TT3F 5TT3G 5TT3H 4YHAB 4YHAC 4YHAD 4YHAE 4YHAF 4YHAG 4YHAH 5TT8A 5TT8B 5TT8C 5TT8D 5TT8E 5TT8F 5TT8G 5TT8H 5TUOB 5TUOC 5TUOD 5TUOE 5TUOF 5TUOG 5TUOH 5TV3A 5TV3B 5TV3C 5TV3D 5TV3E 5TV3F 5TV3G 5TV3H
similar chains in the pdb database (40% sequence similarity)

 
            
               
#similar chains in the KnotProt database (40% sequence similarity)
 4XFW A;  5TT3 A;  5TUO A; 
               
               
#similar chains, but unknotted
 4YGF A;  4YHA A;                               
               
           
#similar chains in the pdb database (40% sequence similarity)
 4XFW B;  4YGF B;  4YGF C;  4YGF D;  4YGF E;  4YGF F;  4YGF G;  4YGF H;  5TT3 B;  5TT3 C;  5TT3 D;  5TT3 E;  5TT3 F;  5TT3 G;  5TT3 H;  4YHA B;  4YHA C;  4YHA D;  4YHA E;  4YHA F;  4YHA G;  4YHA H;  5TT8 A;  5TT8 B;  5TT8 C;  5TT8 D;  5TT8 E;  5TT8 F;  5TT8 G;  5TT8 H;  5TUO B;  5TUO C;  5TUO D;  5TUO E;  5TUO F;  5TUO G;  5TUO H;  5TV3 A;  5TV3 B;  5TV3 C;  5TV3 D;  5TV3 E;  5TV3 F;  5TV3 G;  5TV3 H; 
           

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling