5WTUA

Crystal structure of dnde g21/24k mutant involved in dna phosphorothioation
Warning
  • Chain breaks within knot 31 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
Genus: 34
Knot K -31

  Help Knotting data interpretation Full screen
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
-31 8-98 91 1-7, 99-105 7 7 knot
Chain Sequence
MLPNRMALSRQTEDQLKKLKKY-KITPNIAARLAFFRSVESEFRYSPERDSKKLDGTLVLDKITWLGETLQATELVLKMLYPQLEQKALIKAWAAHVEDGIAALR
Whole chain analysis

  Help Knotoid data interpretation Full screen
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1


  Help Knotoid subchains data interpretation Full screen
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1m 6-100 95 1-5, 101-104 5 4 knot
view details
2.1m 7-92 86 1-6 101-104 93-100 6 4 slipknot
sequence length 105
structure length 104
publication title Crystal structure of DndE G21/24K mutant involved in DNA phosphorothioation
rcsb
molecule tags Dna binding protein
molecule keywords DNA sulfur modification protein DndE
source organism Escherichia coli
missing residues 23
total genus Genus: 34
ec nomenclature
pdb deposition date 2016-12-14
KnotProt deposition date 2018-02-21
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

  
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...
How to cite
KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling