| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 47-c-56-b-97-c-95 | 10-b-65 |
Chain Sequence |
APFLCESEQLLIHPKEELSRNNSMVWIVNTKDYKQGVRIEKCLKRQLGKPCNFCDADTECKQLFHYRTLVAVDKVTKKPYKEQVLLPSCCKCAKILSTG
|
| sequence length |
99
|
| structure length |
99
|
| publication title |
Structure and dynamics of Toll immunoreceptor activation in the mosquito Aedes aegypti.
pubmed doi rcsb |
| molecule tags |
Immune system
|
| molecule keywords |
Toll-like receptor
|
| source organism |
Aedes aegypti
|
| ec nomenclature | |
| pdb deposition date | 2020-11-24 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
