Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K

  Help Knotting data interpretation
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
+ 31 23-255 233 1-22, 256-258 22 2 slipknot
Fingerprint Knot forming loop Loop type
K +31
Chain closureHis4 <-> Lys261
... His97 <->
Bridging ionZn301
<-> His95 ... His4		 probabilistic
K +31 His4 ... His97 <->
Bridging ionZn301
<-> His120 ...
Chain closureLys261 <-> His4
 probabilistic
K +31
Chain closureHis4 <-> Lys261
... His120 <->
Bridging ionZn301
<-> His95 ... His4		 probabilistic
Chain Sequence
HHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGCAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLESVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
How to cite
KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling