| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
+31 | 108-186 | 79 | 1-107 | 202-468 | 187-201 | 107 | 267 | slipknot |
Chain Sequence |
VAAPVAFGFPALSTPGAGGLAVSISAGALSAAIADIMAALKGPFKFGLWGVALYGVLPSQIAKDDPNMMSKIVTSLPADDITESPVSSLPLDKATVNVNVRVVDDVKDERQNISVVSGVPMSVPVVDAKPTERPGVFTASIPGAPVLNISVNNSTPAVQTLSPGVTNNTDKDVRPAFGTQGGNTRDAVIRFPKDSGHNAVYVSVSDVLSPDQVKQRQDEENRRQQEWDATHPVEAAERNYERARAELNQANEDVARNQERQAKAVQVYNSRKSELDAANKTLADAIAEIKQFNRFAHDPMAGGHRMWQMAGLKAQRAQTDVNNKQAAFDAAAKEKSDADAALSSAMESRKKKEDKKRSAENNLNDEKNKPRKGFKDYGHDYHPAPKTENIKGLGDLKPGIPKTPKQNGGGKRKRWTGDKGRKIYEWDSQHGELEGYRASDGQHLGSFDPKTGNQLKGPDPKRNIKKYL
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
3.1 | 23-189 | 167 | 1-15, 200-468 | 16-22, 190-199 | 15 | 269 | slipknot | |||
| view details |
|
3.1 | 64-189 | 126 | 1-55, 198-468 | 56-63, 190-197 | 55 | 271 | slipknot | |||
| view details |
|
3.1 | 66-189 | 124 | 1-63, 197-468 | 64-65, 190-196 | 63 | 272 | slipknot | |||
| view details |
|
3.1 | 69-188 | 120 | 1-63, 199-468 | 64-68, 189-198 | 63 | 270 | slipknot |
| sequence length |
468
|
| structure length |
468
|
| publication title |
Crystal structure of colicin E3: implications for cell entry and ribosome inactivation.
pubmed doi rcsb |
| molecule tags |
Ribosome inhibitor, hydrolase
|
| molecule keywords |
COLICIN E3
|
| source organism |
Escherichia coli str. k12 substr.
|
| total genus |
 Genus: 107
|
| ec nomenclature |
ec
3.1.21.-: |
| pdb deposition date | 2001-06-09 |
| KnotProt deposition date | 2014-07-31 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF06958 | Pyocin_S | S-type Pyocin |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Orthogonal Bundle | Helix Hairpins | Helix Hairpins | ||
| Alpha Beta | Roll | Ribonuclease domain of colicin e3 (Residues 456-551) | Ribonuclease domain of colicin E3 |
#chains in the KnotProt database with same CATH superfamily 1JCH A; 2B5U A; #chains in the KnotProt database with same CATH topology 1JCH A; 2B5U A; 1P49 A; #chains in the KnotProt database with same CATH homology 1JCH A; 2B5U A;
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
