1JCHA

Crystal structure of colicin e3 in complex with its immunity protein
Slipknot S +31 +31 +31 +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 108-186 79 1-107 202-468 187-201 107 267 slipknot
Chain Sequence
VAAPVAFGFPALSTPGAGGLAVSISAGALSAAIADIMAALKGPFKFGLWGVALYGVLPSQIAKDDPNMMSKIVTSLPADDITESPVSSLPLDKATVNVNVRVVDDVKDERQNISVVSGVPMSVPVVDAKPTERPGVFTASIPGAPVLNISVNNSTPAVQTLSPGVTNNTDKDVRPAFGTQGGNTRDAVIRFPKDSGHNAVYVSVSDVLSPDQVKQRQDEENRRQQEWDATHPVEAAERNYERARAELNQANEDVARNQERQAKAVQVYNSRKSELDAANKTLADAIAEIKQFNRFAHDPMAGGHRMWQMAGLKAQRAQTDVNNKQAAFDAAAKEKSDADAALSSAMESRKKKEDKKRSAENNLNDEKNKPRKGFKDYGHDYHPAPKTENIKGLGDLKPGIPKTPKQNGGGKRKRWTGDKGRKIYEWDSQHGELEGYRASDGQHLGSFDPKTGNQLKGPDPKRNIKKYL
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 23-189 167 1-15, 200-468 16-22, 190-199 15 269 slipknot
view details
3.1 64-189 126 1-55, 198-468 56-63, 190-197 55 271 slipknot
view details
3.1 66-189 124 1-63, 197-468 64-65, 190-196 63 272 slipknot
view details
3.1 69-188 120 1-63, 199-468 64-68, 189-198 63 270 slipknot
sequence length 468
structure length 468
publication title Crystal structure of colicin E3: implications for cell entry and ribosome inactivation.
pubmed doi rcsb
molecule tags Ribosome inhibitor, hydrolase
molecule keywords COLICIN E3
source organism Escherichia coli str. k12 substr.
total genus Genus: 107
ec nomenclature ec 3.1.21.-:
pdb deposition date 2001-06-09
KnotProt deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06958 Pyocin_S S-type Pyocin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.620 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1jchA02
3.10.380.10 Alpha Beta Roll Ribonuclease domain of colicin e3 (Residues 456-551) Ribonuclease domain of colicin E3 1jchA03
1JCHA 2B5UA
chains in the KnotProt database with same CATH superfamily
1JCHA 1P49A 2B5UA
chains in the KnotProt database with same CATH topology
1JCHA 2B5UA
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 1JCH A;  2B5U A; 
#chains in the KnotProt database with same CATH topology
 1JCH A;  1P49 A;  2B5U A; 
#chains in the KnotProt database with same CATH homology
 1JCH A;  2B5U A; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling