| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
|
-31 | 115-288 | 174 | 1-114, 289-369 | 114 | 80 | slipknot |
Chain Sequence |
EPLYPVQVSSADARLMVFDKTEGTWRLLCSSRSNARVAGLSCEEMGFLRALTHSELDVRTAGAAGTSGFFCVDEGRLPHTQRLLEVISVCDCPRGRFLAAICQDCGRRKLP---IVGGRDTSLGRWPWQVSLRYDGAHLCGGSLLSGDWVLTAAHCFPERNRVLSRWRVFAGAVAQASPHGLQLGVQAVVYHGGYLPFRDPNSEENSNDIALVHLSSPLPLTEYIQPVCLPAAGQALVDGKICTVTGWGNTQYYGQQAGVLQEARVPIISNDVCNGADFYGNQIKPKMFCAGYPEGGIDACQGDSGGPFVCEDSISRTPRWRLCGIVSWGTGCALAQKPGVYTKVSDFREWIFQAIKTHSEASGMVTQL
|
Knotoid cutoff: 0.5


Knotoid matrix content: 1
| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
|
|
3.1m | 112-307 | 196 | 1-111 | 318-366 | 308-317 | 111 | 49 | slipknot | |
| view details |
|
|
3.1m | 112-317 | 206 | 1-111 | 319-366 | 318-318 | 111 | 48 | slipknot | |
| view details |
|
|
2.1m | 84-318 | 235 | 1-83 | 323-366 | 319-322 | 83 | 44 | slipknot | |
| view details |
|
|
2.1m | 79-322 | 244 | 1-7, 324-366 | 8-78, 323-323 | 7 | 43 | slipknot | ||
| view details |
|
|
2.1m | 106-318 | 213 | 1-83, 323-366 | 84-105, 319-322 | 83 | 44 | slipknot | ||
| view details |
|
|
2.1m | 106-322 | 217 | 1-91, 324-366 | 92-105, 323-323 | 91 | 43 | slipknot | ||
| view details |
|
|
2.1m | 112-303 | 192 | 1-27, 308-366 | 28-111, 304-307 | 27 | 59 | slipknot |
| sequence length |
369
|
| structure length |
366
|
| publication title |
Hepatocyte growth factor is a preferred in vitro substrate for human hepsin, a membrane-anchored serine protease implicated in prostate and ovarian cancers
pubmed doi rcsb |
| molecule tags |
Hydrolase/hydrolase inhibitor
|
| molecule keywords |
Serine protease hepsin
|
| source organism |
Homo sapiens
|
| missing residues |
112-114
|
| total genus |
Genus: 100
|
| ec nomenclature |
ec
3.4.21.106: Hepsin. ec 3.4.21.106: Hepsin. ec 3.4.21.106: Hepsin. |
| pdb deposition date | 2005-03-30 |
| KnotProt deposition date | 2018-09-14 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF09272 | Hepsin-SRCR | Hepsin, SRCR |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Beta Barrel | Thrombin, subunit H | Trypsin-like serine proteases | ||
| Mainly Beta | Beta Barrel | Thrombin, subunit H | Trypsin-like serine proteases | ||
| Alpha Beta | Roll | Mac-2 Binding Protein | SRCR-like domain |
#chains in the KnotProt database with same CATH superfamily 1JWT A; 5CE1 A; 1Z8G A; 1YBW A; #chains in the KnotProt database with same CATH topology 1JWT A; 5CE1 A; 1Z8G A; 1YBW A; #chains in the KnotProt database with same CATH homology 1JWT A; 5CE1 A; 1Z8G A; 1YBW A;
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...