5CE1A

Crystal structure of serine protease hepsin in complex with inhibitor
Warning
  • Chain breaks within knot 31 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
Slipknot S -31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
-31 114-265 152 1-113, 266-369 113 103 slipknot
Chain Sequence
EPLYPVQVSSADARLMVFDKTEGTWRLLCSSRSNARVAGLSCEEMGFLRALTHSELDVRTAGANGTSGFFCVDEGRLPHTQRLLEVISVCDCPRGRFLAAICQDCGRRKL----IVGGRDTSLGRWPWQVSLRYDGAHLCGGSLLSGDWVLTAAHCFPERNRVLSRWRVFAGAVAQASGLQL--GVQAVVYHGGYLPFRPNSENS-NDIA-LVHLSSPLPLTEYIQPVCLPAAGQALVDGKICTVTGWGNTQYYGQQAGVLQEARVPIISNDVCNGADFYGNQIKPKMFCAGYPEGGIDACQGDSGGPFVCEDSISRTPRWRLCGIVSWGTGCALAQKPGVYTKVSDFREWIFQAIKTHSEASGMVTQL
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1m 111-303 193 1-110 314-361 304-313 110 48 slipknot
view details
2.1m 38-313 276 1-37 317-361 314-316 37 45 slipknot
view details
2.1m 36-316 281 1-2, 318-361 3-35, 317-317 2 44 slipknot
view details
2.1m 106-298 193 1-28, 304-361 29-105, 299-303 28 58 slipknot
view details
2.1m 101-313 213 1-37, 318-361 38-100, 314-317 37 44 slipknot
view details
2.1m 106-313 208 1-100, 318-361 101-105, 314-317 100 44 slipknot
sequence length 369
structure length 361
publication title Crystal Structure of Serine protease Hepsin in complex with Inhibitor
rcsb
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Serine protease hepsin
source organism Homo sapiens
missing residues 111-114, 179-180, 200, 204
total genus Genus: 93
ec nomenclature
pdb deposition date 2015-07-06
KnotProt deposition date 2018-09-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5ce1A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5ce1A03
3.10.250.10 Alpha Beta Roll Mac-2 Binding Protein SRCR-like domain 5ce1A01
1YBWA 1JWTA 1Z8GA 5CE1A
chains in the KnotProt database with same CATH superfamily
1YBWA 1JWTA 1Z8GA 5CE1A
chains in the KnotProt database with same CATH topology
1YBWA 1JWTA 1Z8GA 5CE1A
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 1YBW A;  1JWT A;  1Z8G A;  5CE1 A; 
#chains in the KnotProt database with same CATH topology
 1YBW A;  1JWT A;  1Z8G A;  5CE1 A; 
#chains in the KnotProt database with same CATH homology
 1YBW A;  1JWT A;  1Z8G A;  5CE1 A; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling