1TI2A

Crystal structure of pyrogallol-phloroglucinol transhydroxylase from pelobacter acidigallici
Slipknot S +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 121-558 438 1-120 563-875 559-562 120 313 slipknot
Chain Sequence
MGEVVRLTNSSTGGPVFVYVKDGKIIRMTPMDFDDAVDAPSWKIEARGKTFTPPRKTSIAPYTAGFKSMIYSDLRIPYPMKRKSFDPNGERNPQLRGAGLSKQDPWSDYERISWDEATDIVVAEINRIKHAYGPSAILSTPSSHHMWGNVGYRHSTYFRFMNMMGFTYADHNPDSWEGWHWGGMHMWGFSWRLGNPEQYDLLEDGLKHAEMIVFWSSDPETNSGIYAGFESNIRRQWLKDLGVDFVFIDPHMNHTARLVADKWFSPKIGTDHALSFAIAYTWLKEDSYDKEYVAANAHGFEEWADYVLGKTDGTPKTCEWAEEESGVPACEIRALARQWAKKNTYLAAGGLGGWGGACRASHGIEWARGMIALATMQGMGKPGSNMWSTTQGVPLDYEFYFPGYAEGGISGDCENSAAGFKFAWRMFDGKTTFPSPSNLNTSAGQHIPRLKIPECIMGGKFQWSGKGFAGGDISHQLHQYEYPAPGYSKIKMFWKYGGPHLGTMTATNRYAKMYTHDSLEFVVSQSIWFEGEVPFADIILPACTNFERWDISEFANCSGYIPDNYQLCNHRVISLQAKCIEPVGESMSDYEIYRLFAKKLNIEEMFSEGKDELAWCEQYFNATDMPKYMTWDEFFKKGYFVVPDNPNRKKTVALRWFAEGREKDTPDWGPRLNNQVCRKGLQTTTGKVEFIATSLKNFEEQGYIDEHRPSMHTYVPAWESQKHSPLAVKYPLGMLSPHPRFSMHTMGDGKNSYMNYIKDHRVEVDGYKYWIMRVNSIDAEARGIKNGDLIRAYNDRGSVILAAQVTECLQPGTVHSYESCAVYDPLGTAGKSADRGGCINILTPDRYISKYACGMANNTALVEIEKWDGDKYEIY
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
sequence length 875
structure length 875
publication title Crystal structure of pyrogallol-phloroglucinol transhydroxylase, an Mo enzyme capable of intermolecular hydroxyl transfer between phenols
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Pyrogallol hydroxytransferase large subunit
ec nomenclature ec 1.97.1.2: Pyrogallol hydroxytransferase.
pdb deposition date 2004-06-02
KnotProt deposition date 2014-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00384 Molybdopterin Molybdopterin oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling
Application loaded.