| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
|
+31 | 51-559 | 509 | 1-50 | 563-875 | 560-562 | 50 | 313 | slipknot |
Chain Sequence |
MGEVVRLTNSSTGGPVFVYVKDGKIIRMTPMDFDDAVDAPSWKIEARGKTFTPPRKTSIAPYTAGFKSMIYSDLRIPYPMKRKSFDPNGERNPQLRGAGLSKQDPWSDYERISWDEATDIVVAEINRIKHAYGPSAILSTPSSHHMWGNVGYRHSTYFRFMNMMGFTYADHNPDSWEGWHWGGMHMWGFSWRLGNPEQYDLLEDGLKHAEMIVFWSSDPETNSGIYAGFESNIRRQWLKDLGVDFVFIDPHMNHTARLVADKWFSPKIGTDHALSFAIAYTWLKEDSYDKEYVAANAHGFEEWADYVLGKTDGTPKTCEWAEEESGVPACEIRALARQWAKKNTYLAAGGLGGWGGACRASHGIEWARGMIALATMQGMGKPGSNMWSTTQGVPLDYEFYFPGYAEGGISGDCENSAAGFKFAWRMFDGKTTFPSPSNLNTSAGQHIPRLKIPECIMGGKFQWSGKGFAGGDISHQLHQYEYPAPGYSKIKMFWKYGGPHLGTMTATNRYAKMYTHDSLEFVVSQSIWFEGEVPFADIILPACTNFERWDISEFANCSGYIPDNYQLCNHRVISLQAKCIEPVGESMSDYEIYRLFAKKLNIEEMFSEGKDELAWCEQYFNATDMPKYMTWDEFFKKGYFVVPDNPNRKKTVALRWFAEGREKDTPDWGPRLNNQVCRKGLQTTTGKVEFIATSLKNFEEQGYIDEHRPSMHTYVPAWESQKHSPLAVKYPLGMLSPHPRFSMHTMGDGKNSYMNYIKDHRVEVDGYKYWIMRVNSIDAEARGIKNGDLIRAYNDRGSVILAAQVTECLQPGTVHSYESCAVYDPLGTAGKSADRGGCINILTPDRYISKYACGMANNTALVEIEKWDGDKYEIY
|
Knotoid cutoff: 0.5


Knotoid matrix content: 1
| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type |
|---|
| sequence length |
875
|
| structure length |
875
|
| publication title |
Crystal structure of pyrogallol-phloroglucinol transhydroxylase, an Mo enzyme capable of intermolecular hydroxyl transfer between phenols
pubmed doi rcsb |
| molecule tags |
Oxidoreductase
|
| molecule keywords |
Pyrogallol hydroxytransferase large subunit
|
| ec nomenclature |
ec
1.97.1.2: Pyrogallol hydroxytransferase. |
| pdb deposition date | 2004-07-22 |
| KnotProt deposition date | 2014-10-07 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| M | PF00384 | Molybdopterin | Molybdopterin oxidoreductase |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...