1VLFM

Crystal structure of pyrogallol-phloroglucinol transhydroxylase from pelobacter acidigallici complexed with inhibitor 1,2,4,5-tetrahydroxy-benzene
Slipknot S +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 96-558 463 1-95 561-875 559-560 95 315 slipknot
Chain Sequence
MGEVVRLTNSSTGGPVFVYVKDGKIIRMTPMDFDDAVDAPSWKIEARGKTFTPPRKTSIAPYTAGFKSMIYSDLRIPYPMKRKSFDPNGERNPQLRGAGLSKQDPWSDYERISWDEATDIVVAEINRIKHAYGPSAILSTPSSHHMWGNVGYRHSTYFRFMNMMGFTYADHNPDSWEGWHWGGMHMWGFSWRLGNPEQYDLLEDGLKHAEMIVFWSSDPETNSGIYAGFESNIRRQWLKDLGVDFVFIDPHMNHTARLVADKWFSPKIGTDHALSFAIAYTWLKEDSYDKEYVAANAHGFEEWADYVLGKTDGTPKTCEWAEEESGVPACEIRALARQWAKKNTYLAAGGLGGWGGACRASHGIEWARGMIALATMQGMGKPGSNMWSTTQGVPLDYEFYFPGYAEGGISGDCENSAAGFKFAWRMFDGKTTFPSPSNLNTSAGQHIPRLKIPECIMGGKFQWSGKGFAGGDISHQLHQYEYPAPGYSKIKMFWKYGGPHLGTMTATNRYAKMYTHDSLEFVVSQSIWFEGEVPFADIILPACTNFERWDISEFANCSGYIPDNYQLCNHRVISLQAKCIEPVGESMSDYEIYRLFAKKLNIEEMFSEGKDELAWCEQYFNATDMPKYMTWDEFFKKGYFVVPDNPNRKKTVALRWFAEGREKDTPDWGPRLNNQVCRKGLQTTTGKVEFIATSLKNFEEQGYIDEHRPSMHTYVPAWESQKHSPLAVKYPLGMLSPHPRFSMHTMGDGKNSYMNYIKDHRVEVDGYKYWIMRVNSIDAEARGIKNGDLIRAYNDRGSVILAAQVTECLQPGTVHSYESCAVYDPLGTAGKSADRGGCINILTPDRYISKYACGMANNTALVEIEKWDGDKYEIY
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
2.1 9-554 546 1-8 565-875 555-564 8 311 slipknot
view details
2.1 57-554 498 1-16, 567-875 17-56, 555-566 16 309 slipknot
view details
2.1 76-558 483 1-64, 563-875 65-75, 559-562 64 313 slipknot
view details
2.1 81-556 476 1-72, 565-875 73-80, 557-564 72 311 slipknot
view details
2.1 114-554 441 1-74, 567-875 75-113, 555-566 74 309 slipknot
sequence length 875
structure length 875
publication title Crystal structure of pyrogallol-phloroglucinol transhydroxylase, an Mo enzyme capable of intermolecular hydroxyl transfer between phenols
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Pyrogallol hydroxytransferase large subunit
ec nomenclature ec 1.97.1.2: Pyrogallol hydroxytransferase.
pdb deposition date 2004-07-22
KnotProt deposition date 2014-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00384 Molybdopterin Molybdopterin oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling