1Z8GA

Crystal structure of the extracellular region of the transmembrane serine protease hepsin with covalently bound preferred substrate.
Warning
  • Chain breaks within knotoid 31 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
  • Chain breaks within knotoid 31 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
  • Chain breaks within knotoid 31 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
  • Chain breaks within knotoid 31 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
Slipknot S -31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
-31 115-288 174 1-114, 289-369 114 80 slipknot
Chain Sequence
EPLYPVQVSSADARLMVFDKTEGTWRLLCSSRSNARVAGLSCEEMGFLRALTHSELDVRTAGAAGTSGFFCVDEGRLPHTQRLLEVISVCDCPRGRFLAAICQDCGRRKLP---IVGGRDTSLGRWPWQVSLRYDGAHLCGGSLLSGDWVLTAAHCFPERNRVLSRWRVFAGAVAQASPHGLQLGVQAVVYHGGYLPFRDPNSEENSNDIALVHLSSPLPLTEYIQPVCLPAAGQALVDGKICTVTGWGNTQYYGQQAGVLQEARVPIISNDVCNGADFYGNQIKPKMFCAGYPEGGIDACQGDSGGPFVCEDSISRTPRWRLCGIVSWGTGCALAQKPGVYTKVSDFREWIFQAIKTHSEASGMVTQL
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1m 112-307 196 1-111 318-366 308-317 111 49 slipknot
view details
3.1m 112-317 206 1-111 319-366 318-318 111 48 slipknot
view details
2.1m 84-318 235 1-83 323-366 319-322 83 44 slipknot
view details
2.1m 79-322 244 1-7, 324-366 8-78, 323-323 7 43 slipknot
view details
2.1m 106-318 213 1-83, 323-366 84-105, 319-322 83 44 slipknot
view details
2.1m 106-322 217 1-91, 324-366 92-105, 323-323 91 43 slipknot
view details
2.1m 112-303 192 1-27, 308-366 28-111, 304-307 27 59 slipknot
sequence length 369
structure length 366
publication title Hepatocyte growth factor is a preferred in vitro substrate for human hepsin, a membrane-anchored serine protease implicated in prostate and ovarian cancers
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Serine protease hepsin
source organism Homo sapiens
missing residues 112-114
total genus Genus: 100
ec nomenclature ec 3.4.21.106: Hepsin.
ec 3.4.21.106: Hepsin.
ec 3.4.21.106: Hepsin.
pdb deposition date 2005-03-30
KnotProt deposition date 2018-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09272 Hepsin-SRCR Hepsin, SRCR
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1z8gA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1z8gA03
3.10.250.10 Alpha Beta Roll Mac-2 Binding Protein SRCR-like domain 1z8gA01
5CE1A 1YBWA 1Z8GA 1JWTA
chains in the KnotProt database with same CATH superfamily
5CE1A 1YBWA 1Z8GA 1JWTA
chains in the KnotProt database with same CATH topology
5CE1A 1YBWA 1Z8GA 1JWTA
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 5CE1 A;  1YBW A;  1Z8G A;  1JWT A; 
#chains in the KnotProt database with same CATH topology
 5CE1 A;  1YBW A;  1Z8G A;  1JWT A; 
#chains in the KnotProt database with same CATH homology
 5CE1 A;  1YBW A;  1Z8G A;  1JWT A; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling