2B5UA

Crystal structure of colicin e3 v206c mutant in complex with its immunity protein
Slipknot S +31 +31 +31 +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 116-189 74 1-115 204-470 190-203 115 267 slipknot
Chain Sequence
SAVAAPVAFGFPALSTPGAGGLAVSISAGALSAAIADIMAALKGPFKFGLWGVALYGVLPSQIAKDDPNMMSKIVTSLPADDITESPVSSLPLDKATVNVNVRVVDDVKDERQNISVVSGVPMSCPVVDAKPTERPGVFTASIPGAPVLNISVNNSTPAVQTLSPGVTNNTDKDVRPAGFTQGGNTRDAVIRFPKDSGHNAVYVSVSDVLSPDQVKQRQDEENRRQQEWDATHPVEAAERNYERARAELNQANEDVARNQERQAKAVQVYNSRKSELDAANKTLADAIAEIKQFNRFAHDPMAGGHRMWQMAGLKAQRAQTDVNNKQAAFDAAAKEKSDADAALSSAMESRKKKEDKKRSAENNLNDEKNKPRKGFKDYGHDYHPAPKTENIKGLGDLKPGIPKTPKQNGGGKRKRWTGDKGRKIYEWDSQHGELEGYRASDGQHLGSFDPKTGNQLKGPDPKRNIKKYL
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
2.1 28-189 162 1-27 204-470 190-203 27 267 slipknot
view details
2.1 74-190 117 1-56, 198-470 57-73, 191-197 56 273 slipknot
view details
3.1 64-197 134 1-57, 201-470 58-63, 198-200 57 270 slipknot
view details
2.1 71-197 127 1-63, 201-470 64-70, 198-200 63 270 slipknot
view details
3.1 74-198 125 1-62, 205-470 63-73, 199-204 62 266 slipknot
view details
3.1 114-191 78 1-107, 203-470 108-113, 192-202 107 268 slipknot
publication title Crystal Structure Of Colicin E3 In Complex With Its Immunity Protein
rcsb
structure length 470
molecule tags Ribosome inhibitor, hydrolase
source organism Escherichia coli
sequence length 470
total genus Genus: 142
molecule keywords Colicin E3
ec nomenclature ec 3.1.-.-:
pdb deposition date 2005-09-29
KnotProt deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06958 Pyocin_S S-type Pyocin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.620 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2b5uA02
3.10.380.10 Alpha Beta Roll Ribonuclease domain of colicin e3 (Residues 456-551) Ribonuclease domain of colicin E3 2b5uA03
2B5UA 1JCHA
chains in the KnotProt database with same CATH superfamily
1P49A 2B5UA 1JCHA
chains in the KnotProt database with same CATH topology
2B5UA 1JCHA
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 2B5U A;  1JCH A; 
#chains in the KnotProt database with same CATH topology
 1P49 A;  2B5U A;  1JCH A; 
#chains in the KnotProt database with same CATH homology
 2B5U A;  1JCH A; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling