3ED7A

Replacement of val3 in human thymidylate synthase affects its kinetic properties and intracellular stability
Warning
  • Chain breaks within knot 31 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
Knot K +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 6-215 210 1-5, 216-289 5 74 knot
Chain Sequence
LXXXXPPHGELQYLGQIQHILRCGVRKDDRTGTGTLSVFGMQARYSLRDEFPLLTTKRVFWKGVLEELLWFIKGSTNAKELSS-----WDANGSRDFLDSLGFSTREEGDLGPVYGFQWRHFGAEYRDMESDYSGQGVDQLQRVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVNSELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKVEKIDDFKAEDFQIEGYNPHPTIKM
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 6-268 263 1-5, 269-284 5 16 knot
view details
3.1 5-209 205 1-4 219-284 210-218 4 66 slipknot
view details
2.1 6-218 213 1-5 256-284 219-255 5 29 slipknot
view details
3.1 5-256 252 1-4 268-284 257-267 4 17 slipknot
sequence length 289
structure length 284
publication title Replacement of Val3 in human thymidylate synthase affects its kinetic properties and intracellular stability .
pubmed doi rcsb
molecule tags Transferase
molecule keywords Thymidylate synthase
source organism Homo sapiens
missing residues 84-88
total genus Genus: 79
ec nomenclature ec 2.1.1.45: Thymidylate synthase.
pdb deposition date 2008-09-02
KnotProt deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00303 Thymidylat_synt Thymidylate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.572.10 Alpha Beta 2-Layer Sandwich Thymidylate Synthase; Chain A Thymidylate Synthase, chain A 3ed7A00
3ED7A
chains in the KnotProt database with same CATH superfamily
3ED7A
chains in the KnotProt database with same CATH topology
3ED7A
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 3ED7 A; 
#chains in the KnotProt database with same CATH topology
 3ED7 A; 
#chains in the KnotProt database with same CATH homology
 3ED7 A; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling