| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
+31 | 25-257 | 233 | 1-24, 258-260 | 24 | 3 | knot |
Chain Sequence |
AKEWGYASHNGPDHWHELFPNAKGENQSPIELHTKDIRHDPSLQPWSVSYDGGSAKTILNNGKTCHVVFDDTYDRSMLRGGPLPGPYRLRQFHLHWGSSDDHGSEHTVDGVKYAAELHLVHWNPKYNTFKEALKQRDGIAVIGIFLKIGHENGEFQIFLDALDKIKTKGKEAPFTKFDPSSLFPASRDYWTYQGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLLSSAENEPPVPLVSNWRPPQPINNRVVRASFK
|
| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | ||||
|---|---|---|---|---|---|---|---|---|---|---|---|
|
|
+ 31 | 25-256 | 232 | 1-24, 257-260 | 24 | 4 | knot |
| Fingerprint | Knot forming loop | Loop type | ||||
|---|---|---|---|---|---|---|
|
|
K +31 | Chain closureAla2 <-> Lys261 ... His96 <-> Bridging ionZn262 <-> His94 ... Ala2 |
probabilistic | |||
|
|
K +31 | Ala2 ... His96 <-> Bridging ionZn262 <-> His119 ... Chain closureLys261 <-> Ala2 |
probabilistic | |||
|
|
K +31 | Ala2 ... His94 <-> Bridging ionZn262 <-> His119 ... Chain closureLys261 <-> Ala2 |
probabilistic |
Chain Sequence |
AKEWGYASHNGPDHWHELFPNAKGENQSPIELHTKDIRHDPSLQPWSVSYDGGSAKTILNNGKTCHVVFDDTYDRSMLRGGPLPGPYRLRQFHLHWGSSDDHGSEHTVDGVKYAAELHLVHWNPKYNTFKEALKQRDGIAVIGIFLKIGHENGEFQIFLDALDKIKTKGKEAPFTKFDPSSLFPASRDYWTYQGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLLSSAENEPPVPLVSNWRPPQPINNRVVRASFK
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
3.1 | 28-258 | 231 | 1-27, 259-259 | 27 | 1 | knot | ||||
| view details |
 |
2.1 | 26-253 | 228 | 1-25 | 259-259 | 254-258 | 25 | 1 | slipknot |
| sequence length |
259
|
| structure length |
259
|
| publication title |
Structural and kinetic analysis of proton shuttle residues in the active site of human carbonic anhydrase III.
pubmed doi rcsb |
| molecule tags |
Lyase
|
| molecule keywords |
Carbonic anhydrase 3
|
| source organism |
Homo sapiens
|
| total genus |
 Genus: 72
|
| ec nomenclature |
ec
4.2.1.1: Carbonate dehydratase. |
| pdb deposition date | 2011-12-06 |
| KnotProt deposition date | 2018-10-18 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF00194 | Carb_anhydrase | Eukaryotic-type carbonic anhydrase |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
