3UYNA

Hca 3
Warning
  • Chain breaks within knotoid 41 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
Knot K +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 25-257 233 1-24, 258-260 24 3 knot
Chain Sequence
AKEWGYASHNGPDHWHELFPNAKGENQSPIELHTKDIRHDPSLQPWSVSYDGGSAKTILNNGKTCHVVFDDTYDRSMLRGGPLPGPYRLRQFHLHWGSSDDHGSEHTVDGVKYAAELHLVHWNPKYNTFKEALKQRDGIAVIGIFLKIGHENGEFQIFLDALDKIKTKGKEAPFTKFDPSSLFPASRDYWTYQGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLLSSAENEPPVPLVSNWRPPQPINNRVVRASFK
Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K 3x +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
+ 31 25-256 232 1-24, 257-260 24 4 knot
Fingerprint Knot forming loop Loop type
K +31
Chain closureAla2 <-> Lys261
... His96 <->
Bridging ionZn262
<-> His94 ... Ala2
probabilistic
K +31 Ala2 ... His96 <->
Bridging ionZn262
<-> His119 ...
Chain closureLys261 <-> Ala2
probabilistic
K +31 Ala2 ... His94 <->
Bridging ionZn262
<-> His119 ...
Chain closureLys261 <-> Ala2
probabilistic
Chain Sequence
AKEWGYASHNGPDHWHELFPNAKGENQSPIELHTKDIRHDPSLQPWSVSYDGGSAKTILNNGKTCHVVFDDTYDRSMLRGGPLPGPYRLRQFHLHWGSSDDHGSEHTVDGVKYAAELHLVHWNPKYNTFKEALKQRDGIAVIGIFLKIGHENGEFQIFLDALDKIKTKGKEAPFTKFDPSSLFPASRDYWTYQGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLLSSAENEPPVPLVSNWRPPQPINNRVVRASFK
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 28-258 231 1-27, 259-259 27 1 knot
view details
2.1 26-253 228 1-25 259-259 254-258 25 1 slipknot
sequence length 259
structure length 259
publication title Structural and kinetic analysis of proton shuttle residues in the active site of human carbonic anhydrase III.
pubmed doi rcsb
molecule tags Lyase
molecule keywords Carbonic anhydrase 3
source organism Homo sapiens
total genus Genus: 72
ec nomenclature ec 4.2.1.1: Carbonate dehydratase.
pdb deposition date 2011-12-06
KnotProt deposition date 2018-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00194 Carb_anhydrase Eukaryotic-type carbonic anhydrase
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling