| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
+31 | 10-214 | 205 | 1-9 | 324-379 | 215-323 | 9 | 56 | slipknot |
Chain Sequence |
LPPKLLLVSFDGFRADYLKNYEFPHLQNFIKEGVLVEHVKNVFITKTFPNHYSIVTGLYEESHGIVANSMYDAVTKKHFSDSNDKDPFWWNEAVPIWVTNQLQENRSSAAAMWPGTDVPIHDTISSYFMNYNSSVSFEERLNNITMWLNNSNPPVTFATLYWEEPDASGHKYGPEDKENMSRVLKKIDDLIGDLVQRLKMLGLWENLNVIITSDHGMTQCSQDRLINLDSCIDHSYYTLIDLSPVAAILPKINRTEVYNKLKNCSPHMNVYLKEDIPNRFYYQHNDRIQPIILVADEGWTIVLNESSQKLGDHGYDNSLPSMHPFLAAHGPAFHKGYKHSTINIVDIYPMMCHILGLKPHPNNGTFGHTKCLLVDQWCI
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
2.1 | 6-213 | 208 | 1-5 | 219-379 | 214-218 | 5 | 161 | slipknot | ||
| view details |
|
2.1 | 10-215 | 206 | 1-1, 317-379 | 2-9, 216-316 | 1 | 63 | slipknot | |||
| view details |
|
2.1 | 11-254 | 244 | 1-9, 261-379 | 10-10, 255-260 | 9 | 119 | slipknot |
| sequence length |
379
|
| structure length |
379
|
| publication title |
Molecular basis of purinergic signal metabolism by ectonucleotide pyrophosphatase/phosphodiesterases 4 and 1 and implications in stroke.
pubmed doi rcsb |
| molecule tags |
Hydrolase
|
| molecule keywords |
Bis(5'-adenosyl)-triphosphatase ENPP4
|
| source organism |
Homo sapiens
|
| total genus |
 Genus: 128
|
| ec nomenclature |
ec
3.6.1.29: Bis(5'-adenosyl)-triphosphatase. |
| pdb deposition date | 2013-07-19 |
| KnotProt deposition date | 2014-07-31 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF01663 | Phosphodiest | Type I phosphodiesterase / nucleotide pyrophosphatase |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
