| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 43-c-47-b-114-c-112 | 14-b-80 |
Chain Sequence |
KSSCKRHPLYVDFNLIGWGSWIIYPKQYNAYRCEGECPNPVGEEFHPTNHAYIQSLLKRYQPHRVPSTCCVPTELSAISMLYLDENEKVVLKNYQDMVVEGCGCR
|
| sequence length |
105
|
| structure length |
105
|
| publication title |
Designer Nodal/BMP2 Chimeras Mimic Nodal Signaling, Promote Chondrogenesis, and Reveal a BMP2-like Structure.
pubmed doi rcsb |
| molecule tags |
Cytokine, signaling protein
|
| molecule keywords |
Nodal/BMP2 chimera protein
|
| source organism |
Homo sapiens
|
| ec nomenclature | |
| pdb deposition date | 2013-10-04 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
