4XIXA

Carbonic anhydrase cah3 from chlamydomonas reinhardtii in complex with phosphate.
Slipknot S +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 20-236 217 237-238 1-2 3-19 2 1 slipknot
Chain Sequence
AAWNYGEVAGPPTWKGVCATGKRQSPINIPLNTSAPKVDAEMGEFDFAYGSFEKCDVLNTGHGTMQVNFPAGNLAFIGNMELELLQFHFHAPSEHAMDGRRYAMEAHLVHKNKSTGNLAVLGIMLEPGGLIKNPALSTALEVAPEVPLAKKPSPKGINPVMLLPKKSKAGTRPFVHYPGSLTTPPCSEGVDWFVFMQPIKVPDSQILDFMRFVGDNKTYATNTRPLQLLNSRLVEYEL
Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K 3x +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
+ 31 18-221 204 1-17, 222-223 17 1 slipknot
Fingerprint Knot forming loop Loop type
K +31 Ala73 ... His162 <->
Bridging ionZn401
<-> His179 ...
Chain closureLeu310 <-> Ala73
probabilistic
K +31 Ala73 ... His160 <->
Bridging ionZn401
<-> His179 ...
Chain closureLeu310 <-> Ala73
probabilistic
K +31 Ala73 ... His160 <->
Bridging ionZn401
<-> His162 ...
Chain closureLeu310 <-> Ala73
probabilistic
Chain Sequence
AAWNYGEVAGPPTWKGVCATGKRQSPINIPLNTSAPKVDAEMGEFDFAYGSFEKCDVLNTGHGTMQVNFPAGNLAFIGNMELELLQFHFHAPSEHAMDGRRYAMEAHLVHKNKSTGNLAVLGIMLEPGGLIKNPALSTALEVAPEVPLAKKPSPKGINPVMLLPKKSKAGTRPFVHYPGSLTTPPCSEGVDWFVFMQPIKVPDSQILDFMRFVGDNKTYATNTRPLQLLNSRLVEYEL
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
2.1 23-232 210 1-22, 233-238 22 6 knot
publication title Crystal Structure and Functional Characterization of Photosystem II-Associated Carbonic Anhydrase CAH3 in Chlamydomonas reinhardtii.
pubmed doi rcsb
structure length 238
molecule tags Lyase
source organism Chlamydomonas reinhardtii
sequence length 238
total genus Genus: 60
molecule keywords Carbonic anhydrase, alpha type
ec nomenclature
pdb deposition date 2015-01-08
KnotProt deposition date 2018-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00194 Carb_anhydrase Eukaryotic-type carbonic anhydrase
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling