Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
+31 | 20-236 | 217 | 237-238 | 1-2 | 3-19 | 2 | 1 | slipknot |
Chain Sequence |
AAWNYGEVAGPPTWKGVCATGKRQSPINIPLNTSAPKVDAEMGEFDFAYGSFEKCDVLNTGHGTMQVNFPAGNLAFIGNMELELLQFHFHAPSEHAMDGRRYAMEAHLVHKNKSTGNLAVLGIMLEPGGLIKNPALSTALEVAPEVPLAKKPSPKGINPVMLLPKKSKAGTRPFVHYPGSLTTPPCSEGVDWFVFMQPIKVPDSQILDFMRFVGDNKTYATNTRPLQLLNSRLVEYEL
|
Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | ||||
---|---|---|---|---|---|---|---|---|---|---|---|
![]() |
+ 31 | 18-221 | 204 | 1-17, 222-223 | 17 | 1 | slipknot |
Fingerprint | Knot forming loop | Loop type | ||||
---|---|---|---|---|---|---|
|
K +31 | Ala73 ... His162 <-> Bridging ionZn401 <-> His179 ... Chain closureLeu310 <-> Ala73 |
probabilistic | |||
|
K +31 | Ala73 ... His160 <-> Bridging ionZn401 <-> His179 ... Chain closureLeu310 <-> Ala73 |
probabilistic | |||
|
K +31 | Ala73 ... His160 <-> Bridging ionZn401 <-> His162 ... Chain closureLeu310 <-> Ala73 |
probabilistic |
Chain Sequence |
AAWNYGEVAGPPTWKGVCATGKRQSPINIPLNTSAPKVDAEMGEFDFAYGSFEKCDVLNTGHGTMQVNFPAGNLAFIGNMELELLQFHFHAPSEHAMDGRRYAMEAHLVHKNKSTGNLAVLGIMLEPGGLIKNPALSTALEVAPEVPLAKKPSPKGINPVMLLPKKSKAGTRPFVHYPGSLTTPPCSEGVDWFVFMQPIKVPDSQILDFMRFVGDNKTYATNTRPLQLLNSRLVEYEL
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
2.1 | 23-232 | 210 | 1-22, 233-238 | 22 | 6 | knot |
sequence length |
238
|
structure length |
238
|
publication title |
Crystal Structure and Functional Characterization of Photosystem II-Associated Carbonic Anhydrase CAH3 in Chlamydomonas reinhardtii.
pubmed doi rcsb |
molecule tags |
Lyase
|
molecule keywords |
Carbonic anhydrase, alpha type
|
source organism |
Chlamydomonas reinhardtii
|
total genus |
![]() |
ec nomenclature | |
pdb deposition date | 2015-01-08 |
KnotProt deposition date | 2018-10-20 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00194 | Carb_anhydrase | Eukaryotic-type carbonic anhydrase |
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...