5JNXC

The 6.6 a cryo-em structure of the full-length human npc1 in complex with the cleaved glycoprotein of ebola virus
Slipknot S +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 77-141 65 1-76 145-158 142-144 76 14 slipknot
Chain Sequence
RSIPLGVIHNSVLQVSDVDKLVCRDKLSSTNQLRSVGLNLEGNGVATDVPSATKRWGFRSGVPPKVVNYEAGEWAENCYNLEIKKPDGSECLPAAPDGIRGFPRCRYVHKVSGTGPCAGDFAFHKEGAFFLYDRLASTVIYRGTTFAEGVVAFLILPQ
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
2.1 78-139 62 1-77 148-158 140-147 77 11 slipknot
view details
1.1 82-140 59 1-77, 147-158 78-81, 141-146 77 12 slipknot
sequence length 158
structure length 158
publication title Structural Insights into the Niemann-Pick C1 (NPC1)-Mediated Cholesterol Transfer and Ebola Infection
pubmed doi rcsb
molecule tags Membrane protein
molecule keywords Niemann-Pick C1 protein
source organism Homo sapiens
total genus Genus: 31
ec nomenclature
pdb deposition date 2016-05-01
KnotProt deposition date 2016-06-17
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling