5KGLA

2.45a resolution structure of apo independent phosphoglycerate mutase from c. elegans (orthorhombic form)
Slipknot S +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 13-447 435 1-12 471-520 448-470 12 50 slipknot
Chain Sequence
AMANNSSVANKVCLIVIDGWGVSEDPYGNAILNAQTPVMDKLCSGNWAQIEAHGLHVGLPEGLMGNSEVGHLNIGAGRVIYQDIVRINLAVKNNKFVTNESLVDACDRAKNGNGRLHLAGLVSDGGVHSHIDHMFALVKAIKELGVPELYLHFYGDGRDTSPNSGVGFLEQTLEFLEKTTGYGKLATVVGRYYAMDRDNRWERINVAYEAMIGGVGETSDEAGVVEVVRKRYAADETDEFLKPIILQGEKGRVQNDDTIIFFDYRADRMREISAAMGMDRYKDCNSKLAHPSNLQVYGMTQYKAEFPFKSLFPPASNKNVLAEWLAEQKVSQFHCAETEKYAHVTFFFNGGLEKQFEGEERCLVPSPKVATYDLQPEMSAAGVADKMIEQLEAGTHPFIMCNFAPPDMVGHTGVYEAAVKACEATDIAIGRIYEATQKHGYSLMVTADHGNAEKMKAPDGGKHTAHTCYRVPLTLSHPGFKFVDPADRHPALCDVAPTVLAIMGLPQPAEMTGVSIVQKI
Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K 4x -31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
- 31 21-118 98 1-20, 119-167 20 49 knot
Fingerprint Knot forming loop Loop type
K -31
Chain closureAla20 <-> Ile539
... His485 <->
Bridging ionMn602
<-> Asp426 ... His468 <->
Bridging ionZn603
<-> Ser86 ... Ala20
probabilistic
K -31
Chain closureAla20 <-> Ile539
... His485 <->
Bridging ionMn602
<-> His430 ... His468 <->
Bridging ionZn603
<-> Ser86 ... Ala20
probabilistic
K -31
Chain closureAla20 <-> Ile539
... His485 <->
Bridging ionMn602
<-> Asp426 ... Asp467 <->
Bridging ionZn603
<-> Ser86 ... Ala20
probabilistic
K -31
Chain closureAla20 <-> Ile539
... His485 <->
Bridging ionMn602
<-> His430 ... Asp467 <->
Bridging ionZn603
<-> Ser86 ... Ala20
probabilistic
Chain Sequence
AMANNSSVANKVCLIVIDGWGVSEDPYGNAILNAQTPVMDKLCSGNWAQIEAHGLHVGLPEGLMGNSEVGHLNIGAGRVIYQDIVRINLAVKNNKFVTNESLVDACDRAKNGNGRLHLAGLVSDGGVHSHIDHMFALVKAIKELGVPELYLHFYGDGRDTSPNSGVGFLEQTLEFLEKTTGYGKLATVVGRYYAMDRDNRWERINVAYEAMIGGVGETSDEAGVVEVVRKRYAADETDEFLKPIILQGEKGRVQNDDTIIFFDYRADRMREISAAMGMDRYKDCNSKLAHPSNLQVYGMTQYKAEFPFKSLFPPASNKNVLAEWLAEQKVSQFHCAETEKYAHVTFFFNGGLEKQFEGEERCLVPSPKVATYDLQPEMSAAGVADKMIEQLEAGTHPFIMCNFAPPDMVGHTGVYEAAVKACEATDIAIGRIYEATQKHGYSLMVTADHGNAEKMKAPDGGKHTAHTCYRVPLTLSHPGFKFVDPADRHPALCDVAPTVLAIMGLPQPAEMTGVSIVQKI
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 13-453 441 1-12 471-520 454-470 12 50 slipknot
view details
2.1 9-470 462 1-8 472-520 471-471 8 49 slipknot
publication title Macrocycle peptides delineate locked-open inhibition mechanism for microorganism phosphoglycerate mutases.
pubmed doi rcsb
structure length 520
molecule tags Isomerase
source organism Caenorhabditis elegans
sequence length 520
total genus Genus: 195
molecule keywords 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
ec nomenclature
pdb deposition date 2016-06-13
KnotProt deposition date 2018-09-26
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling