| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 4-c-11-b-23-c-21 | 17-b-29 |
Chain Sequence |
GGVCPKILQRCRRDSDCPGACICRGNGYCGYPYDVPDYA
|
| sequence length |
39
|
| structure length |
39
|
| publication title |
Targeted delivery of cyclotides via conjugation to a nanobody
rcsb |
| molecule tags |
De novo protein
|
| molecule keywords |
Two inhibitor peptide topologies 2
|
| ec nomenclature | |
| pdb deposition date | 2017-08-03 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...