5WOWA

Solution nmr structure of cyclotide mcoti-i
Cysteine knot
Loop Piercing
view details
4-c-11-b-23-c-21 17-b-29
Chain Sequence
GGVCPKILQRCRRDSDCPGACICRGNGYCGYPYDVPDYA
sequence length 39
structure length 39
publication title Targeted delivery of cyclotides via conjugation to a nanobody
rcsb
molecule tags De novo protein
molecule keywords Two inhibitor peptide topologies 2
ec nomenclature
pdb deposition date 2017-08-03
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling