Loop | Piercing | ||||
---|---|---|---|---|---|
view details | 4-c-11-b-23-c-21 | 17-b-29 |
Chain Sequence |
GGVCPKILQRCRRDSDCPGACICRGNGYCGYPYDVPDYA
|
sequence length |
39
|
structure length |
39
|
publication title |
Targeted delivery of cyclotides via conjugation to a nanobody
rcsb |
molecule tags |
De novo protein
|
molecule keywords |
Two inhibitor peptide topologies 2
|
ec nomenclature | |
pdb deposition date | 2017-08-03 |
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...