| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | ||||
|---|---|---|---|---|---|---|---|---|---|---|---|
 |
+ 31 | 116-213 | 98 | 1-115, 214-242 | 115 | 29 | knot |
| Fingerprint | Knot forming loop | Loop type | ||||
|---|---|---|---|---|---|---|
|
|
K +31 | Tyr90 ... His303 <-> Bridging ionCo402 <-> Glu336 ... Chain closureSer393 <-> Tyr90 |
probabilistic | |||
|
|
K +31 | Val209 <-> Bridging ionNa405 <-> Ser363 ... Val209 |
ion-based | |||
|
|
K +31 | Asn207 ... Glu336 <-> Bridging ionCo402 <-> Glu367 ... Ser363 <-> Bridging ionNa405 <-> Asn207 |
ion-based | |||
|
|
K +31 | Asn207 <-> Bridging ionNa405 <-> Ser363 ... Glu336 <-> Bridging ionCo402 <-> Asp240 ... Asn207 |
ion-based |
Chain Sequence |
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLLHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
|
| sequence length |
304
|
| structure length |
304
|
| publication title |
Differential inhibition of Sub-Type 1 Methionine aminopeptidases by ovalicin
rcsb |
| molecule tags |
Hydrolase
|
| molecule keywords |
Methionine aminopeptidase 1
|
| source organism |
Homo sapiens
|
| total genus |
 Genus: 102
|
| ec nomenclature | |
| pdb deposition date | 2017-11-08 |
| KnotProt deposition date | 2018-11-21 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
