6G4TA

The crystal structure of uninhibited c183s/c217s mutant of human ca vii
Slipknot S +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 24-255 232 1-23, 256-259 23 3 slipknot
Chain Sequence
GWGYGQDDGPSHWHKLYPIAQGDRQSPINIISSQAVYSPSLQPLELSYEACMSLSITNNGHSVQVDFNDSDDRTVVTGGPLEGPYRLKQFHFHWGKKHDVGSEHTVDGKSFPSELHLVHWNAKKYSTFGEAASAPDGLAVVGVFLETGDEHPSMNRLTDALYMVRFKGTKAQFSCFNPKSLLPASRHYWTYPGSLTTPPLSESVTWIVLREPISISERQMGKFRSLLFTSEDDERIHMVNNFRPPQPLKGRVVKASFRA
Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K 4x +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
+ 31 24-255 232 1-23, 256-259 23 4 knot
Fingerprint Knot forming loop Loop type
K +31 Gly4 ... His94 <->
Bridging ionZn301
<-> His96 ...
Chain closureAla262 <-> Gly4
probabilistic
K +31 Gly4 ... Cys54 <-> Cys178 ...
Chain closureAla262 <-> Gly4
probabilistic
K +31 Gly4 ... His96 <->
Bridging ionZn301
<-> His119 ...
Chain closureAla262 <-> Gly4
probabilistic
K +31 Gly4 ... His94 <->
Bridging ionZn301
<-> His119 ...
Chain closureAla262 <-> Gly4
probabilistic
Chain Sequence
GWGYGQDDGPSHWHKLYPIAQGDRQSPINIISSQAVYSPSLQPLELSYEACMSLSITNNGHSVQVDFNDSDDRTVVTGGPLEGPYRLKQFHFHWGKKHDVGSEHTVDGKSFPSELHLVHWNAKKYSTFGEAASAPDGLAVVGVFLETGDEHPSMNRLTDALYMVRFKGTKAQFSCFNPKSLLPASRHYWTYPGSLTTPPLSESVTWIVLREPISISERQMGKFRSLLFTSEDDERIHMVNNFRPPQPLKGRVVKASFRA
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 26-256 231 1-25, 257-259 25 3 knot
view details
2.1 24-252 229 1-23 258-259 253-257 23 2 slipknot
sequence length 259
structure length 259
publication title The Crystal Structure of a hCA VII Variant Provides Insights into the Molecular Determinants Responsible for Its Catalytic Behavior.
pubmed doi rcsb
molecule tags Lyase
molecule keywords Carbonic anhydrase 7
source organism Homo sapiens
total genus Genus: 73
ec nomenclature
pdb deposition date 2018-03-28
KnotProt deposition date 2018-10-19
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling
Application loaded.