6DZVA

Wild type human serotonin transporter in complex with 15b8 fab bound to ibogaine in occluded conformation
Slipknot S 41 +31 +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 36-272 237 1-19, 537-537 20-35, 273-536 19 1 slipknot
view details
41 10-307 298 1-9 356-537 308-355 9 182 slipknot
Chain Sequence
RETWGKKVDFLLSVIGYAVDLGNVWRFPYICYQNGGGAFLLPYTIMAIFGGIPLFYMELALGQYHRNGCISIWRKICPIFKGIGYAICIIAFYIASYYNTIMAWALYYLISSFTDQLPWTSCKNSWNTGNCTNYFSEDNITWTLHSTSPAEEFYTRHVLQIHRSKGLQDLGGISWQLALCIMLIFTVIYFSIWKGVKTSGKVVWVTATFPYIILSVLLVRGATLPGAWRGVLFYLKPNWQKLLETGVWIDAAAQIFFSLGPGFGVLLAFASYNKFNNNCYQDALVTSVVNCMTSFVSGFVIFTVLGYMAEMRNEDVSEVAKDAGPSLLFITYAEAIANMPASTFFAIIFFLMLITLGLDSTFAGLEGVITAVLDEFPHVWAKRRERFVLAVVITCFFGSLVTLTFGGAYVVKLLEEYATGPAVLTVALIEAVAVSWFYGITQFCRDVKEMLGFSPGWFWRICWVAISPLFLLFIICSFLMSPPQLRLFQYNYPYWSIILGYCIGTSSFICIPTYIAYRLIITPGTFKERIIKSITPE
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.2 10-297 288 1-9 308-537 298-307 9 230 slipknot
view details
4.1 10-307 298 1-9 323-537 308-322 9 215 slipknot
view details
4.1 18-337 320 1-17 357-537 338-356 17 181 slipknot
view details
2.1 40-263 224 1-16, 283-537 17-39, 264-282 16 255 slipknot
view details
2.1 42-362 321 1-16, 402-537 17-41, 363-401 16 136 slipknot
view details
2.1 42-422 381 423-537 1-16 17-41 16 114 slipknot
view details
1.1 38-253 216 1-21, 264-537 22-37, 254-263 21 274 slipknot
view details
1.1 41-285 245 1-25, 304-537 26-40, 286-303 25 234 slipknot
publication title Cryo-EM structure of the human serotonin transporter in complex with ibogaine
rcsb
structure length 537
molecule tags Transport protein/immune system
source organism Homo sapiens
sequence length 537
total genus Genus: 132
molecule keywords Sodium-dependent serotonin transporter
ec nomenclature
pdb deposition date 2018-07-05
KnotProt deposition date 2019-05-07
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling