6DZYA

Cryo-em structure of the ts2-active human serotonin transporter in complex with 15b8 fab and 8b6 scfv bound to ibogaine
Slipknot S 41 +31 +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 37-272 236 273-537 1-20 21-36 20 264 slipknot
view details
41 10-306 297 1-9 363-537 307-362 9 175 slipknot
Chain Sequence
RETWGKKVDFLLSVIGYAVDLGNVWRFPYICYQNGGGAFLLPYTIMAIFGGIPLFYMELALGQYHRNGCISIWRKICPIFKGIGYAICIIAFYIASYYNTIMAWALYYLISSFTDQLPWTSCKNSWNTGNCTNYFSEDNITWTLHSTSPAEEFYTRHVLQIHRSKGLQDLGGISWQLALCIMLIFTVIYFSIWKGVKTSGKVVWVTATFPYIALSVLLVRGATLPGAWRGVLFYLKPNWQKLLETGVWIDAAAQIFFSLGPGFGVLLAFASYNKFNNNCYQDALVTSVVNCMTSFVSGFVIFTVLGYMAEMRNEDVSEVAKDAGPSLLFITYAEAIANMPASTFFAIIFFLMLITLGLDSSFAGLEGVITAVLDEFPHVWAKRRERFVLAVVITCFFGSLVTLTFGGAYVVKLLEEYATGPAVLTVALIEAVAVSWFYGITQFCRDVKEMLGFSPGWFWRICWVAISPLFLLFIIASFLMSPPQLRLFQYNYPYWSIILGYAIGTSSFICIPTYIAYRLIITPGTFKERIIKSITPE
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
4.1 11-307 297 1-10 328-537 308-327 10 210 slipknot
view details
3.2 18-344 327 1-17 361-537 345-360 17 177 slipknot
view details
2.1 41-364 324 1-16, 403-537 17-40, 365-402 16 135 slipknot
view details
2.1 42-422 381 423-537 1-16 17-41 16 114 slipknot
view details
2.1 39-265 227 1-18, 286-537 19-38, 266-285 18 252 slipknot
view details
1.1 37-253 217 1-22, 266-537 23-36, 254-265 22 272 slipknot
view details
1.1 38-285 248 1-25, 304-537 26-37, 286-303 25 234 slipknot
view details
2.1 41-284 244 1-37, 302-537 38-40, 285-301 37 236 slipknot
view details
1.1 41-301 261 1-37, 304-537 38-40, 302-303 37 234 slipknot
publication title Cryo-EM structure of the human serotonin transporter in complex with ibogaine
rcsb
structure length 537
molecule tags Transport protein/immune system
source organism Homo sapiens
sequence length 537
total genus Genus: 164
molecule keywords Sodium-dependent serotonin transporter
ec nomenclature
pdb deposition date 2018-07-05
KnotProt deposition date 2019-05-07
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling